SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0091
         (727 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot...    29   3.1  
At1g77240.1 68414.m08996 AMP-binding protein, putative strong si...    29   4.1  
At3g62370.1 68416.m07006 expressed protein                             28   7.2  
At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic...    27   9.6  
At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /...    27   9.6  

>At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein
           similar to SP|P22418 Fructose-1,6-bisphosphatase,
           chloroplast precursor (EC 3.1.3.11)
           (D-fructose-1,6-bisphosphate 1-phosphohydrolase)
           (FBPase) {Spinacia oleracea}; contains Pfam profile
           PF00316: fructose-1,6-bisphosphatase
          Length = 404

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = -2

Query: 198 ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 88
           A+ + SP+N+ L   S  SS  +D   P PL +VS D
Sbjct: 105 ASLVASPFNSSLGKLSVNSSSGSDRDAPKPLDIVSND 141


>At1g77240.1 68414.m08996 AMP-binding protein, putative strong
           similarity to AMP-binding protein GI:1903034 from
           [Brassica napus]; contains Pfam AMP-binding domain
           PF00501
          Length = 545

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = -1

Query: 430 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 314
           +P  SNS P +VL   + A  + GD     H TT+H W+ET
Sbjct: 5   LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45


>At3g62370.1 68416.m07006 expressed protein
          Length = 361

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%)
 Frame = -1

Query: 415 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 320
           N+ PG +    P   G  NG +RF H+  ++AWN
Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193


>At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical
           to gi_11935088_gb_AAG41964
          Length = 209

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = -2

Query: 210 SPTYATPLMSPYNARLESSSTGSSFPADSPK-PVPLA 103
           SPT +  + SP  A  ++ +  +S P +SPK P P++
Sbjct: 41  SPTKSPAVTSPTTAPAKTPTASASSPVESPKSPAPVS 77


>At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /
           CAF identical to RNA helicase/RNAseIII CAF protein
           GB:AAF03534 GI:6102610 from [Arabidopsis thaliana]
          Length = 1909

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +3

Query: 12  GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKK 143
           G  +P + +SD +  INE+   P   +AK   +E   +   GK+
Sbjct: 70  GGGLPNNGVSDTNSQINEVTVTP-QVIAKETVKENGLQKNGGKR 112


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,590,263
Number of Sequences: 28952
Number of extensions: 366415
Number of successful extensions: 982
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 944
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 982
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1584903024
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).