SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0090
         (604 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g67970.1 68414.m07764 heat shock factor protein, putative (HS...    30   1.4  
At2g18250.1 68415.m02128 cytidylyltransferase domain-containing ...    28   5.5  
At5g18000.1 68418.m02111 transcriptional factor B3 family protei...    27   7.2  
At3g44800.1 68416.m04826 meprin and TRAF homology domain-contain...    27   7.2  
At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei...    27   7.2  

>At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5)
           / heat shock transcription factor, putative (HSTF5)
           identical to heat shock transcription factor 5 (HSF5)
           SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam
           profile: PF00447 HSF-type DNA-binding domain
          Length = 374

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = -2

Query: 288 GRWCEATIRGISLNASKAEASLAESGKDMLTVEPRESGGSKQCD 157
           G W +  +   S   +K + ++ + GKD LT+E  E  G+ + D
Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329


>At2g18250.1 68415.m02128 cytidylyltransferase domain-containing
           protein similar to CoA synthase [Mus musculus]
           GI:21780289, bifunctional phosphopantetheine adenylyl
           transferase / dephospho CoA kinase [Sus scrofa]
           GI:20465246; contains Pfam profile PF01467:
           Cytidylyltransferase
          Length = 176

 Score = 27.9 bits (59), Expect = 5.5
 Identities = 13/58 (22%), Positives = 31/58 (53%)
 Frame = -2

Query: 261 GISLNASKAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 88
           G+S+N  +AE  L++   +++ +    S G+K    T R   +++ ++++ P   + S
Sbjct: 119 GLSVNRKRAERGLSQLKIEVVEIVSDGSSGNKISSSTLRKMEAEKASKQKQPAEEKAS 176


>At5g18000.1 68418.m02111 transcriptional factor B3 family protein
           contains Pfam profile PF02362: B3 DNA binding domain
          Length = 307

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 10/28 (35%), Positives = 20/28 (71%)
 Frame = +2

Query: 467 RNDRKSRHRRIKKQVAMNAWLPQASYPC 550
           R +RKS ++ +KK+  + +W  ++S+PC
Sbjct: 135 REERKSIYKDVKKEEEIESW-SESSHPC 161


>At3g44800.1 68416.m04826 meprin and TRAF homology domain-containing
           protein / MATH domain-containing protein
          Length = 564

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +2

Query: 11  EPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSH 163
           +PR R  LY D  +  + + K+T S+D+   NG +   S+ E   R+ + H
Sbjct: 149 KPRKRMRLYGDGGAVSSHLHKETSSVDV---NGFQVLPSQAESVKRIFERH 196


>At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein /
           hsp20 family protein contains Pfam profile: PF00011
           Hsp20/alpha crystallin family
          Length = 285

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = -3

Query: 239 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 99
           RPK   P  A + ++WSP S  A +  + +VA  +  A   D+   +D
Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,959,469
Number of Sequences: 28952
Number of extensions: 262650
Number of successful extensions: 663
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 650
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 663
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1197101088
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).