SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0088
         (672 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g54020.2 68414.m06155 myrosinase-associated protein, putative...    31   0.70 
At1g21695.1 68414.m02716 hydroxyproline-rich glycoprotein family...    30   1.2  
At5g08230.1 68418.m00965 PWWP domain-containing protein putative...    30   1.6  
At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote...    29   2.8  
At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei...    28   6.5  
At4g27120.2 68417.m03898 expressed protein                             27   8.6  
At4g27120.1 68417.m03897 expressed protein                             27   8.6  
At4g26190.1 68417.m03770 expressed protein                             27   8.6  
At1g03930.1 68414.m00378 protein kinase (ADK1) identical to dual...    27   8.6  

>At1g54020.2 68414.m06155 myrosinase-associated protein, putative
           strong similarity to myrosinase-associated proteins
           GI:1769968, GI:1769970, GI:1216389,GI:1216391 from
           [Brassica napus]; contains InterPro Entry IPR001087
           Lipolytic enzyme, G-D-S-L family
          Length = 372

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = -3

Query: 502 LACGSQAFIATLLFDPSMSALPIIAKQNSPSVGLFT 395
           + C S + +  LL  P +  L  I+ QN P+VGLFT
Sbjct: 1   MECSSVSVLGILLVFPLLHNLVTISGQNLPAVGLFT 36


>At1g21695.1 68414.m02716 hydroxyproline-rich glycoprotein family
           protein contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 217

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 18/69 (26%), Positives = 29/69 (42%)
 Frame = +2

Query: 134 PPDSRGSTVSISLPDSARLASALEAFRHNPADGSFAPPAARRVHEPNVRNCGSSRTEQYY 313
           PP    ST   + P  +  +S     R  P    FAPP + ++  P+  +   S +   Y
Sbjct: 46  PPLKLKSTPPSNSPSPSSSSSFFSESRSRPVS-PFAPPPSFKLKSPSDSDSNCSASPTPY 104

Query: 314 YRNDKPSVG 340
           +R+  P  G
Sbjct: 105 FRSSSPRAG 113


>At5g08230.1 68418.m00965 PWWP domain-containing protein putative
            transcription factor (HUA2) - Arabidopsis thaliana,
            EMBL:AF116556
          Length = 1445

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = +2

Query: 122  HCLEPPDSR-GSTVSISLPDSARLASALEAFRHNPADGSFAPPA 250
            HCL PP +      SI+LP S+    ++ +    P    FAPPA
Sbjct: 1162 HCLPPPTAPLAPAQSIALPPSSITRPSMPSHPSLPLQPGFAPPA 1205


>At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein
           beta-ketoacyl-CoA synthase - Simmondsia
           chinensis,PID:g1045614
          Length = 451

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = -1

Query: 657 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 544
           LS  R   W  RAK  L+Q+  TH+  E T+Y+S  ++
Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317


>At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein /
           hsp20 family protein contains Pfam profile: PF00011
           Hsp20/alpha crystallin family
          Length = 285

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = -2

Query: 200 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-SDVEAHLD 60
           RPK   P  A + ++WSP S  A +  + +VA  +  A  +D+   +D
Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216


>At4g27120.2 68417.m03898 expressed protein
          Length = 298

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 1/85 (1%)
 Frame = -1

Query: 300 VREEPQFRTFGSCTRRAAGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSK-Q 124
           V E PQ +   +  R A GG ++        AS + +++ E+G      +  E+GG++ +
Sbjct: 35  VAEPPQVQPRENVAR-AGGGRRMRRRPAASGASSSTSNVQENGSGSEDEDEDEAGGTQAR 93

Query: 123 CDFTSRVSHSKREKRRRSPFGSRRS 49
                     +RE +R++   +R S
Sbjct: 94  ASKKKEKKRQEREAQRQAEEATRES 118


>At4g27120.1 68417.m03897 expressed protein
          Length = 298

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 1/85 (1%)
 Frame = -1

Query: 300 VREEPQFRTFGSCTRRAAGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSK-Q 124
           V E PQ +   +  R A GG ++        AS + +++ E+G      +  E+GG++ +
Sbjct: 35  VAEPPQVQPRENVAR-AGGGRRMRRRPAASGASSSTSNVQENGSGSEDEDEDEAGGTQAR 93

Query: 123 CDFTSRVSHSKREKRRRSPFGSRRS 49
                     +RE +R++   +R S
Sbjct: 94  ASKKKEKKRQEREAQRQAEEATRES 118


>At4g26190.1 68417.m03770 expressed protein
          Length = 1067

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 10/31 (32%), Positives = 19/31 (61%)
 Frame = -3

Query: 97   FKTREATSKPIWIAEIDAIGFFLNTCITAPK 5
            FKT+E   KP+++ ++  +   + TCI+  K
Sbjct: 944  FKTQEKKDKPLFLKDLRRVWDHIGTCISCGK 974


>At1g03930.1 68414.m00378 protein kinase (ADK1) identical to dual
           specificity kinase 1 (ADK1) [Arabidopsis thaliana]
           gi|1216484|gb|AAB47968; supported by cDNA gi:18700076
           and gi:1216483.  Note: differences between cDNAs in the
           11th exon, possibly due to errors or alternative
           splicing.
          Length = 471

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 1/77 (1%)
 Frame = -1

Query: 273 FGSCTRRAAGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSK-QCDFTSRVSH 97
           +GS +RRA   +  PS+    + S++ + L  S   + TV  R S   + Q    SR S 
Sbjct: 388 YGSSSRRAIPSSSRPSSAGGPSDSRSSSRLVTSTGGVGTVSNRASTSQRIQAGNESRTSS 447

Query: 96  SKREKRRRSPFGSRRSM 46
             R  R       RRS+
Sbjct: 448 FSRAARNTREDPLRRSL 464


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,882,410
Number of Sequences: 28952
Number of extensions: 310857
Number of successful extensions: 883
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 864
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 883
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1422784080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).