SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0086
         (739 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-...    31   0.60 
At3g55780.1 68416.m06198 glycosyl hydrolase family 17 protein si...    30   1.4  
At1g50260.1 68414.m05635 C2 domain-containing protein low simila...    30   1.4  
At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put...    30   1.8  
At5g03420.1 68418.m00295 dentin sialophosphoprotein-related cont...    29   4.3  
At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S...    29   4.3  
At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str...    29   4.3  
At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /...    29   4.3  
At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative...    28   5.6  
At5g22740.1 68418.m02656 glycosyl transferase family 2 protein s...    28   7.4  
At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi...    28   7.4  
At1g67340.1 68414.m07665 zinc finger (MYND type) family protein ...    28   7.4  
At1g22340.1 68414.m02795 UDP-glucoronosyl/UDP-glucosyl transfera...    28   7.4  
At5g05360.2 68418.m00577 expressed protein similar to unknown pr...    27   9.8  
At5g05360.1 68418.m00578 expressed protein similar to unknown pr...    27   9.8  
At3g47910.1 68416.m05224 expressed protein low similarity to non...    27   9.8  
At1g75010.1 68414.m08709 MORN (Membrane Occupation and Recogniti...    27   9.8  

>At5g39900.1 68418.m04839 GTP-binding protein LepA, putative
           GTP-binding protein GUF1 - Saccharomyces cerevisiae,
           PIR:S50374
          Length = 661

 Score = 31.5 bits (68), Expect = 0.60
 Identities = 22/66 (33%), Positives = 34/66 (51%)
 Frame = -3

Query: 695 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLN 516
           LG +H  PA +I+R P PP  +S   +++++F     E    +CY S V        K +
Sbjct: 231 LGLEHVLPA-VIERIPPPPG-ISESPLRMLLFDSFFNEYKGVICYVSVVDGMLS---KGD 285

Query: 515 RVSFPA 498
           +VSF A
Sbjct: 286 KVSFAA 291


>At3g55780.1 68416.m06198 glycosyl hydrolase family 17 protein
           similar to beta-1,3-glucanase precursor GI:4097948 from
           [Oryza sativa]
          Length = 429

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 12/42 (28%), Positives = 22/42 (52%)
 Frame = -3

Query: 734 TATSVPATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKV 609
           TA + P T+   T+G  +  PA I     L P+R++ + + +
Sbjct: 18  TAIATPTTTSATTIGVTYSTPASISGTVQLSPDRIAEKVVSM 59


>At1g50260.1 68414.m05635 C2 domain-containing protein low
           similarity to CLB1 [Lycopersicon esculentum] GI:2789434;
           contains Pfam profile PF00168: C2 domain
          Length = 675

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 102 RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 218
           R+RVLRPS  + + + +S  FR  S     T   R A N
Sbjct: 37  RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75


>At2g28990.1 68415.m03526 leucine-rich repeat protein kinase,
           putative similar to light repressible receptor protein
           kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376;
           contains leucine rich repeat (LRR) domains,
           Pfam:PF00560; contains protein kinase domain,
           Pfam:PF00069
          Length = 884

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 15/45 (33%), Positives = 21/45 (46%)
 Frame = +1

Query: 85  TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 219
           T+ T SG       R++L+      R+  D HD +  PFNG   T
Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222


>At5g03420.1 68418.m00295 dentin sialophosphoprotein-related
           contains weak similarity to Swiss-Prot:Q9NZW4 dentin
           sialophosphoprotein precursor [Homo sapiens]
          Length = 583

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = +1

Query: 457 SSETTAKGTGLGESAGKETLLSLTLVWHCKET*EV*HKWEIVSRDR 594
           SSETT  G  +G+S G   ++S  L        E+ H  E+ S DR
Sbjct: 374 SSETTKGGEYIGDSLGGPRIMSTPLNGSALALKEIIHATEVNSSDR 419


>At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S
           roibosomal protein L4, Arabidopsis thaliana,
           EMBL:CAA79104
          Length = 407

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 9/37 (24%), Positives = 22/37 (59%)
 Frame = -3

Query: 368 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 258
           ++T  V P ++ F+H  I +  ++ + V+ + GH+ +
Sbjct: 33  VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 69


>At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong
           similarity to 60S ribosomal protein L1 GB:P49691
          Length = 406

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 9/37 (24%), Positives = 22/37 (59%)
 Frame = -3

Query: 368 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 258
           ++T  V P ++ F+H  I +  ++ + V+ + GH+ +
Sbjct: 32  VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 68


>At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /
           CAF identical to RNA helicase/RNAseIII CAF protein
           GB:AAF03534 GI:6102610 from [Arabidopsis thaliana]
          Length = 1909

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = +2

Query: 380 GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKR 511
           G  +P + +SD +  INE+   P   +AK   +E   +   GKR
Sbjct: 70  GGGLPNNGVSDTNSQINEVTVTP-QVIAKETVKENGLQKNGGKR 112


>At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative
           strong similarity to probable NADP-dependent
           oxidoreductase (zeta-crystallin homolog) P1
           [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430],
           Arabidopsis thaliana
          Length = 239

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = -1

Query: 109 RVRIQSET*DDFRECHIKYIQFLRPH 32
           R+RIQ     DF + + K+++FL PH
Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197


>At5g22740.1 68418.m02656 glycosyl transferase family 2 protein
           similar to beta-(1-3)-glucosyl transferase GB:AAC62210
           GI:3687658 from [Bradyrhizobium japonicum], cellulose
           synthase from Agrobacterium tumeficiens [gi:710492] and
           Agrobacterium radiobacter [gi:710493]; contains Pfam
           glycosyl transferase, group 2 family protein domain
           PF00535
          Length = 534

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +1

Query: 37  ASKTVYI*YDTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPF 201
           ASK + I Y  RENR+ ++ G+     GL R +  V+ C +  + D      P F
Sbjct: 154 ASKGINIRYQIRENRVGYKAGA--LKEGLKRSY--VKHCEYVVIFDADFQPEPDF 204


>At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin
           like protein A, Arabidopsis thaliana, gb:Q07970
          Length = 790

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = -3

Query: 659 DRAPLPPNRVSNETMKVVVFQRRSRET 579
           +RAPLP   V  E +  + F +R +ET
Sbjct: 7   NRAPLPSPNVKKEALSSIPFDKRRKET 33


>At1g67340.1 68414.m07665 zinc finger (MYND type) family protein /
           F-box family protein
          Length = 379

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = -3

Query: 710 SPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 573
           S LC LG+  R PAD I+   L   R+    M  +V  R S + I+
Sbjct: 54  SILCKLGSTSRCPADFIN-VLLTCKRLKGLAMNPIVLSRLSPKAIA 98


>At1g22340.1 68414.m02795 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase; similar
           to UDP-glucose glucosyltransferase GI:3928543 from
           [Arabidopsis thaliana]
          Length = 487

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 1/71 (1%)
 Frame = -1

Query: 304 GRNHIASTPARAIAMLCLIRQSDSPCPCQF*ADR*TAVVQNRADRARNETDTTLR-LGRS 128
           G N    + A  + M+C    S+ P  C+F  D     ++   D  R E +T +R L   
Sbjct: 383 GWNSTLESLAGGVPMICWPCFSEQPTNCKFCCDEWGVGIEIGKDVKREEVETVVRELMDG 442

Query: 127 AEGRRTRVRIQ 95
            +G++ R + +
Sbjct: 443 EKGKKLREKAE 453


>At5g05360.2 68418.m00577 expressed protein similar to unknown
           protein (pir||T02500)
          Length = 153

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -3

Query: 650 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 540
           P  P+R S      V  ++ +R+T SHL Y++ V L+
Sbjct: 20  PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56


>At5g05360.1 68418.m00578 expressed protein similar to unknown
           protein (pir||T02500)
          Length = 163

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -3

Query: 650 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 540
           P  P+R S      V  ++ +R+T SHL Y++ V L+
Sbjct: 20  PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56


>At3g47910.1 68416.m05224 expressed protein low similarity to
            nonmuscle myosin heavy chain (NMHC) [Homo sapiens]
            GI:189036; contains Pfam profiles PF04780: Protein of
            unknown function (DUF629), PF04781: Protein of unknown
            function (DUF627)
          Length = 1290

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -3

Query: 698  TLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 603
            T+G+ HR+ AD ++ +PLP   V + +   +V
Sbjct: 972  TIGSDHRSNADSVEHSPLPVAPVGDHSEADIV 1003


>At1g75010.1 68414.m08709 MORN (Membrane Occupation and Recognition
           Nexus) repeat-containing protein
           /phosphatidylinositol-4-phosphate 5-kinase-related low
           similarity to phosphatidylinositol-4-phosphate 5-kinase
           AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains
           Pfam profile PF02493: MORN repeat
          Length = 712

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 4/45 (8%)
 Frame = -1

Query: 361 LPPFTR-ACLNFFTLTFRALG---RNHIASTPARAIAMLCLIRQS 239
           +P F+R A L  F + F +LG   R +  S  AR I ++CL+R S
Sbjct: 15  VPLFSRLALLPTFGVPFSSLGATTRLNCTSRKARRICVMCLVRDS 59


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,013,647
Number of Sequences: 28952
Number of extensions: 335841
Number of successful extensions: 841
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 825
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 841
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1624036432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).