SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0085
         (691 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g28040.1 68416.m03500 leucine-rich repeat transmembrane prote...    32   0.41 
At2g43930.1 68415.m05460 protein kinase family protein contains ...    29   2.9  
At5g38320.1 68418.m04625 expressed protein  ; expression support...    29   3.8  
At1g05030.1 68414.m00504 hexose transporter, putative similar to...    29   3.8  
At4g10890.1 68417.m01772 expressed protein                             28   6.7  
At2g43620.1 68415.m05422 chitinase, putative similar to basic en...    28   6.7  
At3g49060.1 68416.m05360 protein kinase family protein / U-box d...    27   8.9  
At1g11040.1 68414.m01265 DNAJ chaperone C-terminal domain-contai...    27   8.9  

>At3g28040.1 68416.m03500 leucine-rich repeat transmembrane protein
           kinase, putative contains Pfam profiles: PF00560 leucine
           rich repeat, PF00069 eukaryotic protein kinase domain
          Length = 1016

 Score = 31.9 bits (69), Expect = 0.41
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 496 GAGITRLLAPDLPSNCSSLKYLKCTHSDYEARKSPVSLF 612
           G   +  L+ DL +NCSSL+YL  +H+  E  + P +LF
Sbjct: 157 GNSFSGTLSDDLFNNCSSLRYLSLSHNHLEG-QIPSTLF 194


>At2g43930.1 68415.m05460 protein kinase family protein contains
           similarity to NPK1-related protein kinase 2 GI:2342425
           from [Arabidopsis thaliana]
          Length = 204

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = +2

Query: 209 EPRSYSIIPCTKYSSTFLARFEHSNLFKVKLSAHLDTHR 325
           EP    ++ C K S  F + FEH  LFK  +    + H+
Sbjct: 63  EPHIVLLLQCRKKSWCFASEFEHLKLFKGYIDEDEERHK 101


>At5g38320.1 68418.m04625 expressed protein  ; expression supported
           by MPSS
          Length = 212

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = +2

Query: 116 RSKNFTSNVAIRMPPVIPINHYLGVLKTNKIEPRSYSI-IPCTKYSST 256
           RSK       +  P +IPI  +  VL+  +I  + Y + +P   Y+ST
Sbjct: 85  RSKTDKYKTGLPRPEIIPIEDFEPVLEIEEIGDQEYEVKLPLLPYNST 132


>At1g05030.1 68414.m00504 hexose transporter, putative similar to
           hexose transporters from Nicotiana tabacum (GI:8347244),
           Solanum tuberosum (GI:8347246), Arabidopsis thaliana
           (GI:8347250); contains Pfam profile PF00083: major
           facilitator superfamily protein
          Length = 524

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +1

Query: 478 ILVYAIGAG-ITRLLAPDLPSNCSSLKYLKCTHSDYEARKSPVSLFFV 618
           I  +AIGAG +T L+ P+L SN +  K +  + S +      V LFF+
Sbjct: 425 IFSFAIGAGPVTGLIIPELSSNRTRGKIMGFSFSVHWVSNFLVGLFFL 472


>At4g10890.1 68417.m01772 expressed protein
          Length = 527

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = -2

Query: 114 RKTNISESICQRCFHQS-RTKVRGSKAIRYRPSSNRKYV 1
           ++T I   +C RC+H S R K+R S   R   S++   +
Sbjct: 194 KQTKICSRVCSRCYHYSMRQKLRHSLHTRILKSNSENAI 232


>At2g43620.1 68415.m05422 chitinase, putative similar to basic
           endochitinase CHB4 precursor SP:Q06209 from [Brassica
           napus]
          Length = 283

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = +3

Query: 426 CTDSAAHKCN--YELFNRNNFSIRYWSWNYAAAGTRLALQL 542
           C+ S A+ C    + + R    I  W++NY AAG  L L L
Sbjct: 166 CSPSTAYPCTPGKDYYGRGPIQIT-WNYNYGAAGKFLGLPL 205


>At3g49060.1 68416.m05360 protein kinase family protein / U-box
           domain-containing protein contains Pfam profile: PF00069
           Eukaryotic protein kinase domain
          Length = 805

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 12/45 (26%), Positives = 22/45 (48%)
 Frame = +2

Query: 77  HLWQMLSLMFVLRRSKNFTSNVAIRMPPVIPINHYLGVLKTNKIE 211
           H+W +     +  R+ N  SN    MPP++ ++      K+ K+E
Sbjct: 162 HIWFLCKGYLIFTRASNDDSNNRQTMPPLVQLDSDNETRKSEKLE 206


>At1g11040.1 68414.m01265 DNAJ chaperone C-terminal
           domain-containing protein contains Pfam profile PF01556:
           DnaJ C terminal region
          Length = 438

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 2/55 (3%)
 Frame = +3

Query: 321 TEEHRDRILILNRRFLERRLT--DDMLRKRVSITADACTDSAAHKCNYELFNRNN 479
           +E H D    ++RR+LE +    DD++  R  +   +  DS+  K    L + ++
Sbjct: 38  SESHSDADSAIHRRYLEEKFAEEDDLIAARRGLRLQSMDDSSVFKRRSSLLSNSS 92


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,291,524
Number of Sequences: 28952
Number of extensions: 288044
Number of successful extensions: 662
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 648
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 662
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1467502800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).