SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0081
         (629 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g07020.1 68415.m00803 protein kinase family protein contains ...    30   1.1  
At1g65320.1 68414.m07407 CBS domain-containing protein contains ...    30   1.1  
At5g44260.1 68418.m05416 zinc finger (CCCH-type) family protein ...    29   1.9  
At3g17920.1 68416.m02282 leucine-rich repeat family protein cont...    29   3.4  
At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica...    29   3.4  

>At2g07020.1 68415.m00803 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 700

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = -2

Query: 235 DSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 140
           DS     S  RPS+DWF  N+S +  +  SS+
Sbjct: 223 DSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254


>At1g65320.1 68414.m07407 CBS domain-containing protein contains
           Pfam profile PF00571: CBS domain
          Length = 425

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 3/90 (3%)
 Frame = -3

Query: 498 IPITRPRKSPVSLFFVTTSRAGSG*FARLLPSLDVVA-VSQAPSPESNPDSPLPVTTMVV 322
           IP+ R R +P    FV  S      F  +L SLD+VA +++    +      +PV+ +V 
Sbjct: 44  IPVWRKRTTPSLPGFVENSEMRQQRFVGILNSLDIVAFLAKTECLQEEKAMKIPVSEVVS 103

Query: 321 AETTI--ES**GRHLKDASPVLDHGSAKVI 238
            + T+  +   G  L DA  ++  G  +++
Sbjct: 104 PDNTLLKQVDPGTRLIDALEMMKQGVRRLL 133


>At5g44260.1 68418.m05416 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 381

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 3/104 (2%)
 Frame = -3

Query: 495 PITRPRKSPVSLF--FVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTT-MV 325
           P + P  SP      F   SR  +     L+ SLD +++++A +  S+    +P++T  +
Sbjct: 215 PSSSPPLSPADKADAFSRLSRRRTAVLNELISSLDSLSLTEALAASSSSPVTMPISTATM 274

Query: 324 VAETTIES**GRHLKDASPVLDHGSAKVIQIHQN*RLRTRGPPS 193
           +A + + S    H     P LD G  + +Q+ Q+  LR    PS
Sbjct: 275 IASSNLSS--NHHHHRLPPWLDVGD-RDLQLQQSSPLRFALSPS 315


>At3g17920.1 68416.m02282 leucine-rich repeat family protein
           contains leucine rich repeat (LRR) domains, Pfam:PF00560
          Length = 962

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = -3

Query: 417 RLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAE 316
           RLLPSL VV+   +P+ +  P S LP + + V E
Sbjct: 84  RLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLE 117


>At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical
           to gi_3883128_gb_AAC77827
          Length = 133

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 14/36 (38%), Positives = 18/36 (50%)
 Frame = -3

Query: 408 PSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 301
           PS    A + APSP +NP    P T   V++   ES
Sbjct: 39  PSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTES 74


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,326,309
Number of Sequences: 28952
Number of extensions: 281205
Number of successful extensions: 652
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 628
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 652
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1285411824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).