SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0079
         (617 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g17550.1 68415.m02031 expressed protein                             28   4.3  
At1g67970.1 68414.m07764 heat shock factor protein, putative (HS...    28   5.7  
At3g44800.1 68416.m04826 meprin and TRAF homology domain-contain...    27   7.5  
At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei...    27   7.5  
At4g33830.1 68417.m04801 glycosyl hydrolase family 10 protein xy...    27   10.0 
At2g29040.1 68415.m03530 exostosin family protein contains Pfam ...    27   10.0 
At1g03900.1 68414.m00374 expressed protein                             27   10.0 

>At2g17550.1 68415.m02031 expressed protein
          Length = 765

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 18/70 (25%), Positives = 31/70 (44%)
 Frame = +3

Query: 51  RSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSAR 230
           R+ D   +  T  + + D N LRR+++  E E ++      EP     + V +  PD   
Sbjct: 527 RNVDYLSQVSTPDVTVSDENELRRQINELESEVQVRTPVEEEPIQEIETIVDLGNPDKVF 586

Query: 231 LASALEAFGI 260
           +   L A G+
Sbjct: 587 VRDLLVASGL 596


>At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5)
           / heat shock transcription factor, putative (HSTF5)
           identical to heat shock transcription factor 5 (HSF5)
           SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam
           profile: PF00447 HSF-type DNA-binding domain
          Length = 374

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 12/44 (27%), Positives = 22/44 (50%)
 Frame = -2

Query: 292 GRWCEATIRGIMPNASKAEASLAESGKDMLTVEPRESGGSKQCD 161
           G W +  +       +K + ++ + GKD LT+E  E  G+ + D
Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329


>At3g44800.1 68416.m04826 meprin and TRAF homology domain-containing
           protein / MATH domain-containing protein
          Length = 564

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +3

Query: 15  EPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSH 167
           +PR R  LY D  +  + + K+T S+D+   NG +   S+ E   R+ + H
Sbjct: 149 KPRKRMRLYGDGGAVSSHLHKETSSVDV---NGFQVLPSQAESVKRIFERH 196


>At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein /
           hsp20 family protein contains Pfam profile: PF00011
           Hsp20/alpha crystallin family
          Length = 285

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = -3

Query: 243 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 103
           RPK   P  A + ++WSP S  A +  + +VA  +  A   D+   +D
Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216


>At4g33830.1 68417.m04801 glycosyl hydrolase family 10 protein xylan
           endohydrolase isoenzyme X-I, Hordeum
           vulgare,PID:g1813595
          Length = 544

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 23/72 (31%), Positives = 29/72 (40%)
 Frame = -1

Query: 305 HSAERPVVRSYHPRDYAERL*GRSQPSRIRQGYAHCGAPRVGRL*TM*LY*SRFAFKTRD 126
           ++ E P      P  Y E+L    Q  R+R G    G        T  +   R A  T  
Sbjct: 348 YTLEDPTDLKASPAKYLEKL-RELQSIRVR-GNIPLGIGLESHFSTPNIPYMRSALDTLG 405

Query: 125 ATSKPIWIAEID 90
           AT  PIW+ EID
Sbjct: 406 ATGLPIWLTEID 417


>At2g29040.1 68415.m03530 exostosin family protein contains Pfam
           profile: PF03016 exostosin family
          Length = 720

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
 Frame = -1

Query: 323 SDIWFMHSAERPVVRSYHPRDYAERL*GRSQPSRIRQGY--AHCGAPR 186
           S  W  H    P    +HP  YAE +  + +  RI + Y  +  GAPR
Sbjct: 462 SSPWNYHGFAVPYPTYFHPSTYAEIIQWQMRMRRINRRYLFSFVGAPR 509


>At1g03900.1 68414.m00374 expressed protein
          Length = 272

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = -3

Query: 270 SAGLCRTPLRPKPA*PNPARICSLWSPESR--EALNNVTLL 154
           +AG+ R+PL P P  P  +RI S    ESR  E L++++ L
Sbjct: 207 AAGVTRSPLPPPPNDPVASRIASDGCKESRRNEPLSDLSQL 247


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,832,459
Number of Sequences: 28952
Number of extensions: 289422
Number of successful extensions: 739
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 732
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 739
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1246162608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).