SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0076
         (634 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-...    31   0.48 
At5g03420.1 68418.m00295 dentin sialophosphoprotein-related cont...    29   3.4  
At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /...    29   3.4  
At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi...    28   5.9  
At1g67340.1 68414.m07665 zinc finger (MYND type) family protein ...    28   5.9  
At5g05360.2 68418.m00577 expressed protein similar to unknown pr...    27   7.8  
At5g05360.1 68418.m00578 expressed protein similar to unknown pr...    27   7.8  
At3g47910.1 68416.m05224 expressed protein low similarity to non...    27   7.8  

>At5g39900.1 68418.m04839 GTP-binding protein LepA, putative
           GTP-binding protein GUF1 - Saccharomyces cerevisiae,
           PIR:S50374
          Length = 661

 Score = 31.5 bits (68), Expect = 0.48
 Identities = 22/66 (33%), Positives = 34/66 (51%)
 Frame = -2

Query: 441 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLN 262
           LG +H  PA +I+R P PP  +S   +++++F     E    +CY S V        K +
Sbjct: 231 LGLEHVLPA-VIERIPPPPG-ISESPLRMLLFDSFFNEYKGVICYVSVVDGMLS---KGD 285

Query: 261 RVSFPA 244
           +VSF A
Sbjct: 286 KVSFAA 291


>At5g03420.1 68418.m00295 dentin sialophosphoprotein-related
           contains weak similarity to Swiss-Prot:Q9NZW4 dentin
           sialophosphoprotein precursor [Homo sapiens]
          Length = 583

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = +2

Query: 203 SSETTAKGTGLGESAGKETLLSLTLVWHCKET*EV*HKWEIVSRDR 340
           SSETT  G  +G+S G   ++S  L        E+ H  E+ S DR
Sbjct: 374 SSETTKGGEYIGDSLGGPRIMSTPLNGSALALKEIIHATEVNSSDR 419


>At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /
           CAF identical to RNA helicase/RNAseIII CAF protein
           GB:AAF03534 GI:6102610 from [Arabidopsis thaliana]
          Length = 1909

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = +3

Query: 126 GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKR 257
           G  +P + +SD +  INE+   P   +AK   +E   +   GKR
Sbjct: 70  GGGLPNNGVSDTNSQINEVTVTP-QVIAKETVKENGLQKNGGKR 112


>At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin
           like protein A, Arabidopsis thaliana, gb:Q07970
          Length = 790

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = -2

Query: 405 DRAPLPPNRVSNETMKVVVFQRRSRET 325
           +RAPLP   V  E +  + F +R +ET
Sbjct: 7   NRAPLPSPNVKKEALSSIPFDKRRKET 33


>At1g67340.1 68414.m07665 zinc finger (MYND type) family protein /
           F-box family protein
          Length = 379

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = -2

Query: 456 SPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 319
           S LC LG+  R PAD I+   L   R+    M  +V  R S + I+
Sbjct: 54  SILCKLGSTSRCPADFIN-VLLTCKRLKGLAMNPIVLSRLSPKAIA 98


>At5g05360.2 68418.m00577 expressed protein similar to unknown
           protein (pir||T02500)
          Length = 153

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -2

Query: 396 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 286
           P  P+R S      V  ++ +R+T SHL Y++ V L+
Sbjct: 20  PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56


>At5g05360.1 68418.m00578 expressed protein similar to unknown
           protein (pir||T02500)
          Length = 163

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -2

Query: 396 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 286
           P  P+R S      V  ++ +R+T SHL Y++ V L+
Sbjct: 20  PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56


>At3g47910.1 68416.m05224 expressed protein low similarity to
            nonmuscle myosin heavy chain (NMHC) [Homo sapiens]
            GI:189036; contains Pfam profiles PF04780: Protein of
            unknown function (DUF629), PF04781: Protein of unknown
            function (DUF627)
          Length = 1290

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -2

Query: 444  TLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 349
            T+G+ HR+ AD ++ +PLP   V + +   +V
Sbjct: 972  TIGSDHRSNADSVEHSPLPVAPVGDHSEADIV 1003


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,689,406
Number of Sequences: 28952
Number of extensions: 275105
Number of successful extensions: 681
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 659
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 681
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1295224128
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).