SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0071
         (637 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) ...    31   0.64 
At1g74690.1 68414.m08650 calmodulin-binding family protein low s...    29   2.0  
At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p...    29   3.4  

>At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26)
            similar to GI:11993492; RNA binding protein - Homo
            sapiens, EMBL:AB016089 (N-terminus), several ubiquitin
            carboxyl-terminal hydrolases from aa pos. 712
          Length = 1067

 Score = 31.1 bits (67), Expect = 0.64
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = -1

Query: 409  LCLVRSKSGETLMEDRSDSDVQIDRRNWV*GRKTN 305
            +C VR K     M + SDS  ++DRR     R+TN
Sbjct: 928  VCFVRGKEAPKAMLEASDSSFEVDRRTSKRSRRTN 962


>At1g74690.1 68414.m08650 calmodulin-binding family protein low
           similarity to SF16 protein [Helianthus annuus]
           GI:560150; contains Pfam profile PF00612: IQ
           calmodulin-binding motif
          Length = 587

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +3

Query: 99  PLGTVIRSPASSFE*AGVLTHLKFENRLRSFR 194
           P  +V + PAS+FE + V T  +FE   RSFR
Sbjct: 282 PKKSVRKVPASNFESSSVQTSFEFEKPKRSFR 313


>At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80
            subunit, putative similar to contains 6 WD-40 repeats
            (PF00400); katanin p80 subunit (GI:3005601)
            [Strongylocentrotus purpuratus]
          Length = 974

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +3

Query: 36   LGALTLRLVHPTAPVLLTKIGPLGTVIRSPASSFE*AGVLTHLKFEN 176
            LG+ T R V+ +  +LL  +   GTVIRS  S+    GV  H    N
Sbjct: 881  LGSRTERPVNVSLDMLLKLVAVFGTVIRSTVSAPRIVGVDLHANERN 927


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,145,102
Number of Sequences: 28952
Number of extensions: 304304
Number of successful extensions: 661
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 652
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 661
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1305036432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).