SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0055
         (465 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g00700.1 68417.m00096 C2 domain-containing protein contains I...    27   6.2  
At5g62430.1 68418.m07835 Dof-type zinc finger domain-containing ...    27   8.3  

>At4g00700.1 68417.m00096 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 1006

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
 Frame = +2

Query: 32  NCSPKTIFKY-NRKAKEPIVRSDALEVDYGTLTFTAVFPSISDLQLSNAEVFSYVHEINP 208
           +CSP    K+ N+  +     +D   V +    F    PS+   +   A V+SY +E + 
Sbjct: 24  SCSPFVELKFDNQIFRATTKHNDPNPVWHECFYFVVSDPSVLSTRTLEAHVYSYQNEFDA 83

Query: 209 KFILG 223
           K  LG
Sbjct: 84  KPFLG 88


>At5g62430.1 68418.m07835 Dof-type zinc finger domain-containing
           protein similar to H-protein promoter binding factor-2a
           GI:3386546 from [Arabidopsis thaliana]
          Length = 237

 Score = 26.6 bits (56), Expect = 8.3
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +2

Query: 185 SYVHEINPKFILGPLLSFSLDSENKVS 265
           S+ H +      GP+LSFSL  + KVS
Sbjct: 52  SHYHHVTISETNGPVLSFSLGDDQKVS 78


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,068,238
Number of Sequences: 28952
Number of extensions: 133129
Number of successful extensions: 211
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 208
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 211
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 782033640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).