SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0038
         (703 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-rel...    32   0.42 
At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p...    31   0.98 
At2g23340.1 68415.m02787 AP2 domain-containing transcription fac...    29   3.0  
At2g23300.1 68415.m02781 leucine-rich repeat transmembrane prote...    29   3.0  
At1g48960.1 68414.m05487 universal stress protein (USP) family p...    28   5.2  
At2g27810.2 68415.m03372 xanthine/uracil permease family protein...    28   6.9  
At2g27810.1 68415.m03371 xanthine/uracil permease family protein...    28   6.9  
At1g31250.1 68414.m03825 proline-rich family protein contains pr...    28   6.9  

>At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-related
            contains Pfam PF02138: Beige/BEACH domain; contains Pfam
            PF00400: WD domain, G-beta repeat (3 copies)
          Length = 2946

 Score = 31.9 bits (69), Expect = 0.42
 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = -2

Query: 219  VTGTCDAKFLIW-YH*AVTSRTCATESAEGSG 127
            VTG+ D+  L+W  H A TSRT  +E + GSG
Sbjct: 2684 VTGSRDSTVLLWRIHKAFTSRTSVSEPSTGSG 2715


>At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80
            subunit, putative similar to contains 6 WD-40 repeats
            (PF00400); katanin p80 subunit (GI:3005601)
            [Strongylocentrotus purpuratus]
          Length = 974

 Score = 30.7 bits (66), Expect = 0.98
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +3

Query: 378  LGALTLRLVHPTAPVLLTKIGPLGTVIRSPASSFE*AGVLTHLNLR 515
            LG+ T R V+ +  +LL  +   GTVIRS  S+    GV  H N R
Sbjct: 881  LGSRTERPVNVSLDMLLKLVAVFGTVIRSTVSAPRIVGVDLHANER 926


>At2g23340.1 68415.m02787 AP2 domain-containing transcription
           factor, putative 
          Length = 176

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = -3

Query: 152 RRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSSCSRV 6
           R+ A+ G  V  LGA+V  + GG ++   E +E+ R  G   N S  RV
Sbjct: 109 RKAAEVGAQVDALGATVVVNTGGENRGDYEKIENCRKSG---NGSLERV 154


>At2g23300.1 68415.m02781 leucine-rich repeat transmembrane protein
           kinase, putative 
          Length = 773

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 20/62 (32%), Positives = 27/62 (43%)
 Frame = +2

Query: 182 YQIKNLASHVPVTVVYRQNASAPSISGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHG 361
           +   NL   +P + VY  N  + S SG     G     P  IP+S ATV    +T A   
Sbjct: 248 FSFNNLTGSIPDSPVYL-NQKSISFSGNPGLCGGPTRNPCPIPSSPATVSPPTSTPALAA 306

Query: 362 VP 367
           +P
Sbjct: 307 IP 308


>At1g48960.1 68414.m05487 universal stress protein (USP) family
           protein contains Pfam PF00582: universal stress protein
           family; similar to hypothetical protein GI:7770340 from
           [Arabidopsis thaliana]
          Length = 219

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 14/38 (36%), Positives = 18/38 (47%)
 Frame = +1

Query: 55  SRASLEYLLLPPRSAPTEAPSGLTPRPFCALRRARPTR 168
           S+  +  L +P    PT+ P  L P P   L R RP R
Sbjct: 172 SQIEISGLQVPEIPTPTKVPYRLCPSPHAILWRTRPRR 209


>At2g27810.2 68415.m03372 xanthine/uracil permease family protein
           contains Pfam profile: PF00860 permease family
          Length = 660

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -1

Query: 382 PKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 281
           P KR  D+   VGRS   DG +GS +P+R   R+
Sbjct: 114 PVKRRRDSDGVVGRSNGPDGANGSGDPVRRPGRI 147


>At2g27810.1 68415.m03371 xanthine/uracil permease family protein
           contains Pfam profile: PF00860 permease family
          Length = 709

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -1

Query: 382 PKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 281
           P KR  D+   VGRS   DG +GS +P+R   R+
Sbjct: 114 PVKRRRDSDGVVGRSNGPDGANGSGDPVRRPGRI 147


>At1g31250.1 68414.m03825 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965;
           similar to prolin rich protein GB:S44189 GI:433706 from
           [Zea mays]
          Length = 165

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 15/48 (31%), Positives = 22/48 (45%)
 Frame = +1

Query: 43  PRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALRRARPTRYGLMIP 186
           P  +  AS    L PP ++P+  P+G TP    +L    P+     IP
Sbjct: 109 PAGTPNASPSVKLTPPYASPSVRPTGTTPNASPSLTPPNPSPSEKFIP 156


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,354,521
Number of Sequences: 28952
Number of extensions: 364736
Number of successful extensions: 939
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 898
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 937
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1506636208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).