SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0032
         (636 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g38840.1 68415.m04772 guanylate-binding family protein simila...    47   1e-05
At5g46070.1 68418.m05665 guanylate-binding family protein contai...    32   0.37 
At2g36110.1 68415.m04434 3'-5' exonuclease domain-containing pro...    31   0.85 
At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEME...    29   2.6  
At4g36980.1 68417.m05240 expressed protein                             29   2.6  
At1g60850.3 68414.m06850 DNA-directed RNA polymerase, putative i...    29   3.4  
At4g28670.1 68417.m04097 protein kinase family protein contains ...    28   4.5  
At5g54260.1 68418.m06759 DNA repair and meiosis protein (Mre11) ...    28   6.0  
At5g20360.1 68418.m02422 octicosapeptide/Phox/Bem1p (PB1) domain...    28   6.0  
At5g08080.1 68418.m00942 syntaxin, putative (SYP132) similar to ...    28   6.0  
At1g14620.1 68414.m01738 expressed protein                             28   6.0  
At5g50450.1 68418.m06247 zinc finger (MYND type) family protein ...    27   7.9  
At5g14650.1 68418.m01716 polygalacturonase, putative / pectinase...    27   7.9  
At4g18465.1 68417.m02740 RNA helicase, putative similar to SP|Q1...    27   7.9  
At1g68660.1 68414.m07845 expressed protein                             27   7.9  

>At2g38840.1 68415.m04772 guanylate-binding family protein similar
           to SP|Q01514 Interferon-induced guanylate-binding
           protein 1 (Guanine nucleotide-binding protein 1)
           (Interferon-gamma inducible protein MAG-1) {Mus
           musculus}; contains Pfam profile PF02263:
           Guanylate-binding protein, N-terminal domain
          Length = 679

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 30/77 (38%), Positives = 46/77 (59%), Gaps = 2/77 (2%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDS--ESTVRDCATVFA 331
           +GF      +  T GI +W    +  +D G K ++I LDT+G F+S  +S V D   +FA
Sbjct: 87  EGFGVGHMRDTKTKGIWVWGTPLELEID-GVKTSVIYLDTEG-FESVGKSNVYD-DRIFA 143

Query: 330 LSTMLSSVQIYNLSQNI 280
           L+T++SSV IYNL + +
Sbjct: 144 LATVMSSVLIYNLPETV 160


>At5g46070.1 68418.m05665 guanylate-binding family protein contains
           Pfam domains PF02263: Guanylate-binding protein,
           N-terminal domain and PF02841: Guanylate-binding
           protein, C-terminal domain
          Length = 1060

 Score = 31.9 bits (69), Expect = 0.37
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQG--AFDSESTVRDCAT 340
           G   GF      +  T G+ +WS   K T  DG +  ++LLD++G  A+D      D A+
Sbjct: 92  GRSNGFQVASTHKPCTKGLWLWSSPIKRTALDGTEYNLLLLDSEGIDAYDQTMGGIDEAS 151

Query: 339 VFALS 325
           +  LS
Sbjct: 152 LDRLS 156


>At2g36110.1 68415.m04434 3'-5' exonuclease domain-containing
           protein contains Pfam profile PF01612: 3'-5' exonuclease
          Length = 239

 Score = 30.7 bits (66), Expect = 0.85
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = -3

Query: 376 LRQ*IHGARLRDRVRSVHDAVVRSDIQPLAKHPGGRPPAPSL 251
           +R+ IH  R   R+RS H  VV  D+Q     PGG  P P +
Sbjct: 37  IRRWIHSIRFFSRLRSSHPLVVGLDVQ---WTPGGSDPPPDI 75


>At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEMETER
            protein [Arabidopsis thaliana] GI:21743571; contains Pfam
            profile PF00730: HhH-GPD superfamily base excision DNA
            repair protein
          Length = 1729

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -2

Query: 212  PDSLPAAAVPRARLELPLRSALRSG 138
            P+S P  A+P   L LPL  +L SG
Sbjct: 1418 PESYPPVAIPMIELPLPLEKSLASG 1442


>At4g36980.1 68417.m05240 expressed protein
          Length = 560

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = -2

Query: 182 RARLELPLRSALRSGRRHADTVKKIKGI 99
           R+R   P RS  RS +RHAD +  I+G+
Sbjct: 518 RSRSRSPSRSLSRSPKRHADALHLIRGL 545


>At1g60850.3 68414.m06850 DNA-directed RNA polymerase, putative
           identical to RNA polymerase subunit [Arabidopsis
           thaliana] GI:514322; contains Pfam profile PF01000: RNA
           polymerase Rpb3/RpoA insert domain
          Length = 302

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = -3

Query: 94  KQHPELQSLRKHITACFSELA-CFLMPHPGL 5
           + HPE++S+  +++    E A CF+ PHP +
Sbjct: 269 RMHPEVRSIYINLSYALWETALCFVFPHPNI 299


>At4g28670.1 68417.m04097 protein kinase family protein contains
           Pfam domain, PF00069: Protein kinase domain
          Length = 625

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = -1

Query: 462 GILMWSEIFKATLDDGEKVAIILLDTQG 379
           G+  + E+FK TL DG ++AI  L   G
Sbjct: 338 GVGGYGEVFKGTLSDGREIAIKRLHVSG 365


>At5g54260.1 68418.m06759 DNA repair and meiosis protein (Mre11)
           identical to DNA repair and meiosis protein (Mre11)
           GI:5524769 from [Arabidopsis thaliana]
          Length = 720

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +3

Query: 48  HAVMCLRRDCSSGCCLSDTFNLL 116
           HAV  +R +   GC +SD FN+L
Sbjct: 197 HAVQWMRPEVQEGCDVSDWFNIL 219


>At5g20360.1 68418.m02422 octicosapeptide/Phox/Bem1p (PB1)
           domain-containing protein / tetratricopeptide repeat
           (TPR)-containing protein contains Pfam profiles PF00564:
           PB1 domain, PF00515: TPR Domain
          Length = 809

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 10/35 (28%), Positives = 19/35 (54%)
 Frame = -3

Query: 139 DGGMQILSRRLKVSDKQHPELQSLRKHITACFSEL 35
           DG M      +K+  K H E+  +R ++ +C+ +L
Sbjct: 143 DGAMFKYGEAIKILPKDHVEVSHVRANVASCYMQL 177


>At5g08080.1 68418.m00942 syntaxin, putative (SYP132) similar to
           SP|Q9ZSD4 Syntaxin 121 (AtSYP121) (Syntaxin-related
           protein  At-Syr1) {Arabidopsis thaliana}
          Length = 304

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = -3

Query: 145 GADGGMQILSRRLKVSDKQHPELQSLRKHITACFSE 38
           G D G++   ++++V DKQ+ +L  L K + A   E
Sbjct: 29  GGDQGLEDFFKKVQVIDKQYDKLDKLLKKLQASHEE 64


>At1g14620.1 68414.m01738 expressed protein
          Length = 233

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 11/19 (57%), Positives = 13/19 (68%)
 Frame = +2

Query: 155 FVGEAPVAHEELQPLEGSP 211
           FVG AP+AH  +QP E  P
Sbjct: 162 FVGNAPMAHMAIQPTEEMP 180


>At5g50450.1 68418.m06247 zinc finger (MYND type) family protein
           contains Pfam profile PF01753: MYND finger
          Length = 336

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQG 379
           Q   WR   + + T + +W        DDGE VA+ + D  G
Sbjct: 293 QALDWRAKHKVECTPLDLWVAAAAEIGDDGEAVAVEIDDNHG 334


>At5g14650.1 68418.m01716 polygalacturonase, putative / pectinase,
           putative similar to polygalacturonase PG1 GP|5669846,
           PG2 GI:5669848 from [Glycine max]; contains PF00295:
           Glycosyl hydrolases family 28 (polygalacturonases)
          Length = 435

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 23/104 (22%), Positives = 42/104 (40%), Gaps = 4/104 (3%)
 Frame = -1

Query: 507 LQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFAL 328
           LQG + +G    D  G + W+++    +   +  A+    + G   S  T+++       
Sbjct: 139 LQGITIKGKGIIDGRGSVWWNDMMGTKMPRTKPTALRFYGSNGVTVSGITIQNSPQTHLK 198

Query: 327 STMLSSVQIYNLSQNIQED----DLQHLHCSQSTVGWRSRTGAG 208
                S+Q+ + + +   D    D  HL  SQ  V +RS    G
Sbjct: 199 FDNCISIQVSDFTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACG 242


>At4g18465.1 68417.m02740 RNA helicase, putative similar to
           SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase
           HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam
           profiles PF04408: Helicase associated domain (HA2),
           PF00271: Helicase conserved C-terminal domain
          Length = 704

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%)
 Frame = -3

Query: 121 LSRRLKVSDKQ-HPELQSLRKHITACFSELACFLMPH 14
           ++RRL ++ K    +++++RK +TA F   AC L PH
Sbjct: 597 IARRLGITLKSCDGDMEAVRKAVTAGFFANACRLEPH 633


>At1g68660.1 68414.m07845 expressed protein
          Length = 159

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 12/42 (28%), Positives = 24/42 (57%)
 Frame = +2

Query: 368 LSKAPCVSSNIIATFSPSSSVALNISDHMSMPVVSLSEPPRQ 493
           +SK PCV+ +I+ T S S+++       +  P++  + P R+
Sbjct: 27  VSKGPCVNRSILMTLSTSAALGKG-GGVLDKPIIEKTTPGRE 67


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,971,858
Number of Sequences: 28952
Number of extensions: 251844
Number of successful extensions: 860
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 838
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 860
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1305036432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).