SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0021
         (673 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-...    31   0.70 
At4g27520.1 68417.m03952 plastocyanin-like domain-containing pro...    31   0.70 
At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S...    29   3.7  
At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str...    29   3.7  
At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi...    28   6.5  
At1g67340.1 68414.m07665 zinc finger (MYND type) family protein ...    28   6.5  
At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /...    28   6.5  
At5g05360.2 68418.m00577 expressed protein similar to unknown pr...    27   8.6  
At5g05360.1 68418.m00578 expressed protein similar to unknown pr...    27   8.6  
At3g47910.1 68416.m05224 expressed protein low similarity to non...    27   8.6  

>At5g39900.1 68418.m04839 GTP-binding protein LepA, putative
           GTP-binding protein GUF1 - Saccharomyces cerevisiae,
           PIR:S50374
          Length = 661

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = -2

Query: 453 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHV 307
           LG +H  PA +I+R P PP  +S   +++++F     E    +CY S V
Sbjct: 231 LGLEHVLPA-VIERIPPPPG-ISESPLRMLLFDSFFNEYKGVICYVSVV 277


>At4g27520.1 68417.m03952 plastocyanin-like domain-containing
           protein similar to PIR|JC7196 phytocyanin-related
           protein Pn14 {Ipomoea nil}; contains Pfam profile
           PF02298: Plastocyanin-like domain
          Length = 349

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 21/61 (34%), Positives = 27/61 (44%)
 Frame = -2

Query: 567 SLTDVPPQSNSPPGSVLEPDTREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRV 388
           S T  PP S +PPG    P +    +A S  ATSP  ++  K  +P       P PP   
Sbjct: 169 SPTTSPPGSTTPPGGAHSPKSS---SAVS-PATSPPGSMAPKSGSPVSPTTSPPAPPKST 224

Query: 387 S 385
           S
Sbjct: 225 S 225


>At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S
           roibosomal protein L4, Arabidopsis thaliana,
           EMBL:CAA79104
          Length = 407

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 9/37 (24%), Positives = 22/37 (59%)
 Frame = -2

Query: 126 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 16
           ++T  V P ++ F+H  I +  ++ + V+ + GH+ +
Sbjct: 33  VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 69


>At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong
           similarity to 60S ribosomal protein L1 GB:P49691
          Length = 406

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 9/37 (24%), Positives = 22/37 (59%)
 Frame = -2

Query: 126 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 16
           ++T  V P ++ F+H  I +  ++ + V+ + GH+ +
Sbjct: 32  VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 68


>At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin
           like protein A, Arabidopsis thaliana, gb:Q07970
          Length = 790

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = -2

Query: 417 DRAPLPPNRVSNETMKVVVFQRRSRET 337
           +RAPLP   V  E +  + F +R +ET
Sbjct: 7   NRAPLPSPNVKKEALSSIPFDKRRKET 33


>At1g67340.1 68414.m07665 zinc finger (MYND type) family protein /
           F-box family protein
          Length = 379

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = -2

Query: 468 SPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 331
           S LC LG+  R PAD I+   L   R+    M  +V  R S + I+
Sbjct: 54  SILCKLGSTSRCPADFIN-VLLTCKRLKGLAMNPIVLSRLSPKAIA 98


>At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /
           CAF identical to RNA helicase/RNAseIII CAF protein
           GB:AAF03534 GI:6102610 from [Arabidopsis thaliana]
          Length = 1909

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +3

Query: 138 GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENSGERR 269
           G  +P + +SD +  INE+   P   +AK   +E   + +G +R
Sbjct: 70  GGGLPNNGVSDTNSQINEVTVTP-QVIAKETVKENGLQKNGGKR 112


>At5g05360.2 68418.m00577 expressed protein similar to unknown
           protein (pir||T02500)
          Length = 153

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -2

Query: 408 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 298
           P  P+R S      V  ++ +R+T SHL Y++ V L+
Sbjct: 20  PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56


>At5g05360.1 68418.m00578 expressed protein similar to unknown
           protein (pir||T02500)
          Length = 163

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -2

Query: 408 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 298
           P  P+R S      V  ++ +R+T SHL Y++ V L+
Sbjct: 20  PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56


>At3g47910.1 68416.m05224 expressed protein low similarity to
            nonmuscle myosin heavy chain (NMHC) [Homo sapiens]
            GI:189036; contains Pfam profiles PF04780: Protein of
            unknown function (DUF629), PF04781: Protein of unknown
            function (DUF627)
          Length = 1290

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -2

Query: 456  TLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 361
            T+G+ HR+ AD ++ +PLP   V + +   +V
Sbjct: 972  TIGSDHRSNADSVEHSPLPVAPVGDHSEADIV 1003


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,661,827
Number of Sequences: 28952
Number of extensions: 342116
Number of successful extensions: 928
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 897
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 927
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1422784080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).