SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0014
         (389 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g61560.1 68418.m07725 protein kinase family protein contains ...    29   1.5  
At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui...    29   1.5  
At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui...    29   1.5  
At3g47940.1 68416.m05227 DNAJ heat shock protein, putative simil...    28   1.9  
At1g33880.1 68414.m04200 avirulence-responsive family protein / ...    28   2.6  
At1g10300.1 68414.m01160 GTP-binding protein-related contains si...    28   2.6  
At4g31160.1 68417.m04423 transducin family protein / WD-40 repea...    27   3.4  
At3g24840.1 68416.m03116 SEC14 cytosolic factor, putative / phos...    27   3.4  
At5g59650.1 68418.m07479 leucine-rich repeat protein kinase, put...    27   4.5  
At5g56890.1 68418.m07099 protein kinase family protein contains ...    27   5.9  
At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P...    27   5.9  
At3g30230.1 68416.m03820 myosin heavy chain-related similar to M...    27   5.9  
At3g18290.1 68416.m02326 zinc finger protein-related weak alignm...    27   5.9  
At2g47520.1 68415.m05931 AP2 domain-containing transcription fac...    27   5.9  
At1g55860.1 68414.m06406 ubiquitin-protein ligase 1 (UPL1) nearl...    27   5.9  
At5g13080.1 68418.m01499 WRKY family transcription factor WRKY D...    26   7.8  
At3g42770.1 68416.m04468 F-box family protein contains F-box dom...    26   7.8  
At1g79190.1 68414.m09233 expressed protein                             26   7.8  

>At5g61560.1 68418.m07725 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 796

 Score = 28.7 bits (61), Expect = 1.5
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +2

Query: 134 PDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSAR 298
           P +  S+I + FEL+ LK +    +      QS      +  +  NQR+SE++ R
Sbjct: 286 PTSSSSQIHKDFELEKLKIELRHIKGMYAVAQSEVIDASKKMQDLNQRRSEEATR 340


>At4g38600.2 68417.m05463 HECT-domain-containing protein /
            ubiquitin-transferase family protein similar to
            SP|Q14669Thyroid receptor interacting protein 12 (TRIP12)
            {Homo sapiens}; contains Pfam profile PF00632:
            HECT-domain (ubiquitin-transferase)
          Length = 1794

 Score = 28.7 bits (61), Expect = 1.5
 Identities = 16/46 (34%), Positives = 25/46 (54%)
 Frame = +2

Query: 206  QKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGRLVESSMAVS*TYS 343
            Q+ QGA  S   +  E R  + QRQ  + +R R+++S+  V   YS
Sbjct: 1356 QQQQGADGSGSTNEREMRIGRLQRQKVRVSRNRILDSAAKVMEMYS 1401


>At4g38600.1 68417.m05464 HECT-domain-containing protein /
            ubiquitin-transferase family protein similar to
            SP|Q14669Thyroid receptor interacting protein 12 (TRIP12)
            {Homo sapiens}; contains Pfam profile PF00632:
            HECT-domain (ubiquitin-transferase)
          Length = 1888

 Score = 28.7 bits (61), Expect = 1.5
 Identities = 16/46 (34%), Positives = 25/46 (54%)
 Frame = +2

Query: 206  QKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGRLVESSMAVS*TYS 343
            Q+ QGA  S   +  E R  + QRQ  + +R R+++S+  V   YS
Sbjct: 1447 QQQQGADGSGSTNEREMRIGRLQRQKVRVSRNRILDSAAKVMEMYS 1492


>At3g47940.1 68416.m05227 DNAJ heat shock protein, putative similar
           to SP|O89114 DnaJ homolog subfamily B member 5 (Heat
           shock protein Hsp40-3) {Mus musculus}; contains Pfam
           profile PF00226: DnaJ domain
          Length = 350

 Score = 28.3 bits (60), Expect = 1.9
 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +2

Query: 128 LLPDNKRSKIEQMFELQHLKT-KFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSA 295
           +L D ++ +I  ++  + LK+ K P++  ++ +  SS  S   P  HQ++ Q   +A
Sbjct: 57  VLSDPQKRQIYDLYGEEGLKSGKIPNSSSSEASSSSSSSSSRYPHFHQHRPQHPPNA 113


>At1g33880.1 68414.m04200 avirulence-responsive family protein /
           avirulence induced gene (AIG1) family protein similar to
           AIG1 protein SP:P54120 [Arabidopsis thaliana]; contains
           Pfam PF04548: AIG1 family;
          Length = 234

 Score = 27.9 bits (59), Expect = 2.6
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = -2

Query: 145 FIIREKDDYFPICCPAALNAEMR 77
           F  +E +DYFP CCP  L   +R
Sbjct: 150 FEAKEFEDYFPECCPEFLMRVLR 172


>At1g10300.1 68414.m01160 GTP-binding protein-related contains
           similarity to nucleolar GTP-binding protein 1 SP: Q9BZE4
           from [Homo sapiens];
          Length = 687

 Score = 27.9 bits (59), Expect = 2.6
 Identities = 14/49 (28%), Positives = 28/49 (57%)
 Frame = +3

Query: 195 FPRLKKRKELLSHLGNLMTNQDGTKISGRARNRQEDDSSKVVWRYLELI 341
           FPRLK+ +     L +++ N+D  K++    N  ++  SK+   Y++L+
Sbjct: 98  FPRLKEIQPFYEDLLHVLYNKDHYKLALGQVNTAKNKISKIAMDYVKLL 146


>At4g31160.1 68417.m04423 transducin family protein / WD-40 repeat
           family protein contains 2 WD-40 repeats (PF00400);
           KIAA0800 protein, Homo sapiens GI:3882321 EMBL:AB018343
          Length = 1846

 Score = 27.5 bits (58), Expect = 3.4
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +2

Query: 38  LTKSRHDVFLEARSHFGVKRCWTTDGKIIVLLPDN 142
           L +S+  +FLE   HF   R     GK+ +L+ +N
Sbjct: 79  LLESQESLFLEENGHFSNARGSHNSGKLCILIREN 113


>At3g24840.1 68416.m03116 SEC14 cytosolic factor, putative /
           phosphoglyceride transfer protein, putative similar to
           phosphatidylinositol transfer-like protein IV
           (GI:14486707) [Lotus japonicus]; similar to SEC14
           CYTOSOLIC FACTOR (PHOSPHATIDYLINOSITOL/
           PHOSPHATIDYLCHOLINE TRANSFER PROTEIN) GB:P46250 from
           [Candida albicans] (Yeast (1996) 12(11), 1097-1105);
           contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam
           PF03765 : CRAL/TRIO, N-terminus
          Length = 579

 Score = 27.5 bits (58), Expect = 3.4
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +2

Query: 143 KRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGRLVES 316
           +  ++ ++F L+H+ T   S        + S   HD  +R Q   Q+E    GR+ +S
Sbjct: 356 ENGEVAKLFSLRHVNTDMSSPDGGHVRERESHPEHD--KRAQLSNQAEAVGVGRMEQS 411


>At5g59650.1 68418.m07479 leucine-rich repeat protein kinase,
           putative contains leucine rich repeat (LRR) domains,
           Pfam:PF00560; contains protein kinase domain,
           Pfam:PF00069
          Length = 892

 Score = 27.1 bits (57), Expect = 4.5
 Identities = 17/55 (30%), Positives = 25/55 (45%)
 Frame = +3

Query: 186 KPSFPRLKKRKELLSHLGNLMTNQDGTKISGRARNRQEDDSSKVVWRYLELIHRC 350
           +P   + + +  +   +G  +T  D TKI     N   D  S+ VWR LEL   C
Sbjct: 786 QPVIDQSRSKSHISQWVGFELTRGDITKIMDP--NLNGDYESRSVWRVLELAMSC 838


>At5g56890.1 68418.m07099 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 1113

 Score = 26.6 bits (56), Expect = 5.9
 Identities = 11/37 (29%), Positives = 21/37 (56%)
 Frame = +3

Query: 258 DGTKISGRARNRQEDDSSKVVWRYLELIHRCNTKNLV 368
           DGTK++ +   R +   S+     +E++ R + +NLV
Sbjct: 744 DGTKVAVKVLKRDDQQGSREFLAEVEMLSRLHHRNLV 780


>At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS
           reductase homolog (PRH19) identical to
           5'-adenylylsulfate reductase [Arabidopsis thaliana]
           GI:2738756; identical to cDNA PAPS reductase homolog
           (PRH19) GI:1710111
          Length = 465

 Score = 26.6 bits (56), Expect = 5.9
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = +3

Query: 210 KRKELLSHLGNLMTNQDGTKISGRARNRQED 302
           K KE   H GN+  N D  K++G +++   D
Sbjct: 318 KAKECGLHKGNVKENSDDAKVNGESKSAVAD 348


>At3g30230.1 68416.m03820 myosin heavy chain-related similar to
           Myosin heavy chain, non-muscle (Zipper protein) (Myosin
           II)(SP:Q99323) {Drosophila melanogaster}
          Length = 527

 Score = 26.6 bits (56), Expect = 5.9
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +2

Query: 227 QSSGKSHDEPRRHQNQRQSEKSARGRLVESSMA 325
           +S+ +  D+ RRH   +     ARGRL ES  A
Sbjct: 333 KSNAELQDQYRRHDKLQDELSVARGRLSESKSA 365


>At3g18290.1 68416.m02326 zinc finger protein-related weak alignment
           to Pfam profiles: PF00097 Zinc finger, C3HC4 type (RING
           finger) (2 copies)
          Length = 1254

 Score = 26.6 bits (56), Expect = 5.9
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
 Frame = -1

Query: 182 DAEVQTSVQSYCVYYPGEGRLFSHL--LSSSA*RRNES 75
           D  V+   Q+Y + + GE  LF HL  L +SA   +ES
Sbjct: 117 DIRVKNVAQTYSLEHKGESNLFDHLFELLNSATETDES 154


>At2g47520.1 68415.m05931 AP2 domain-containing transcription
           factor, putative
          Length = 171

 Score = 26.6 bits (56), Expect = 5.9
 Identities = 17/42 (40%), Positives = 21/42 (50%)
 Frame = +1

Query: 205 SKSARSSSVIWEIS*RTKTAPKSAAEREIGKRTTRRK*YGGI 330
           SKS    S +  +S R K  P S +E   GKR  R+  Y GI
Sbjct: 13  SKSESEPSQLGSVSSRKKRKPVSVSEERDGKR-ERKNLYRGI 53


>At1g55860.1 68414.m06406 ubiquitin-protein ligase 1 (UPL1) nearly
            identical to ubiquitin-protein ligase 1 [Arabidopsis
            thaliana] GI:7108521; E3, HECT-domain protein family;
            similar to GI:7108521, GB:AAF36454 from [Arabidopsis
            thaliana]
          Length = 3891

 Score = 26.6 bits (56), Expect = 5.9
 Identities = 10/40 (25%), Positives = 28/40 (70%)
 Frame = +3

Query: 192  SFPRLKKRKELLSHLGNLMTNQDGTKISGRARNRQEDDSS 311
            SFPR+K++++  ++L ++  ++  TK+ G+++  + + +S
Sbjct: 1961 SFPRVKRQEDGETNLISMEVDEPTTKVKGKSKVGEPEKAS 2000


>At5g13080.1 68418.m01499 WRKY family transcription factor WRKY DNA
           binding protein - Solanum tuberosum, EMBL:AJ278507
          Length = 145

 Score = 26.2 bits (55), Expect = 7.8
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 221 APQSSGKSHDEPRRHQNQRQSEK 289
           AP  S KSH +P  HQ + +S K
Sbjct: 11  APFLSLKSHSKPELHQGEEESSK 33


>At3g42770.1 68416.m04468 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 532

 Score = 26.2 bits (55), Expect = 7.8
 Identities = 19/60 (31%), Positives = 28/60 (46%)
 Frame = +2

Query: 5   LKGSRVIISEFLTKSRHDVFLEARSHFGVKRCWTTDGKIIVLLPDNKRSKIEQMFELQHL 184
           L+   + I  F  K+R +  LE  SHF +K  +    K+ V L  +   K+E   EL  L
Sbjct: 461 LEDFAIHIKSFRRKARSENELEHISHFSLKMEFLEVLKVYVALTMDDTKKVELTKELLKL 520


>At1g79190.1 68414.m09233 expressed protein
          Length = 1274

 Score = 26.2 bits (55), Expect = 7.8
 Identities = 13/30 (43%), Positives = 17/30 (56%)
 Frame = -2

Query: 358  LVLHL*ISSRYRHTTFDESSSCRFLALPLI 269
            ++L L  S RYR T    +SSC   A PL+
Sbjct: 935  ILLELNRSKRYRRTVGSIASSCLIAATPLL 964


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,159,835
Number of Sequences: 28952
Number of extensions: 156519
Number of successful extensions: 553
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 540
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 553
length of database: 12,070,560
effective HSP length: 73
effective length of database: 9,957,064
effective search space used: 557595584
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).