BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0022 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45780.1 68416.m04953 protein kinase / nonphototropic hypocot... 30 1.7 >At3g45780.1 68416.m04953 protein kinase / nonphototropic hypocotyl protein 1 (NPH1) / phototropin identical to SP|O48963 Nonphototropic hypocotyl protein 1 (EC 2.7.1.37) (Phototropin) {Arabidopsis thaliana}, cDNA nonphototropic hypocotyl 1 (NPH1) GI:2832240; contains Pfam profiles PF00069:Protein kinase domain and PF00785:PAC motif Length = 996 Score = 29.9 bits (64), Expect = 1.7 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 5/71 (7%) Frame = +3 Query: 225 PVSYVASGVFNVVNYTSTQDV*LTYNFTYVSRTDDNTI-----ILLLWPNTLSRSTRFKK 389 P+ Y ++G FN+ YTS + V F S TD + + L N R +KK Sbjct: 210 PIMYASAGFFNMTGYTSKEVVGRNCRFLQGSGTDADELAKIRETLAAGNNYCGRILNYKK 269 Query: 390 NLLEFTLRLTI 422 + F LTI Sbjct: 270 DGTSFWNLLTI 280 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,759,028 Number of Sequences: 28952 Number of extensions: 197713 Number of successful extensions: 245 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 245 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -