SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0040
         (740 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g11130.1 68416.m01349 clathrin heavy chain, putative similar ...    28   7.5  
At3g08530.1 68416.m00990 clathrin heavy chain, putative similar ...    28   7.5  
At5g53350.1 68418.m06630 ATP-dependent Clp protease ATP-binding ...    27   9.9  
At1g11060.1 68414.m01267 expressed protein                             27   9.9  

>At3g11130.1 68416.m01349 clathrin heavy chain, putative similar to
           Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo
           sapiens]
          Length = 1705

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%)
 Frame = -1

Query: 320 NRNKKRL--NLLSHWDIETKEELGDFSQTQSFEL*LTLIERGR 198
           N+NKK L  N L+   +E  EELGD  +T   +L L +  + R
Sbjct: 454 NQNKKNLLENWLAEDKLECSEELGDLVKTVDNDLALKIYIKAR 496


>At3g08530.1 68416.m00990 clathrin heavy chain, putative similar to
           Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo
           sapiens]
          Length = 1703

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%)
 Frame = -1

Query: 320 NRNKKRL--NLLSHWDIETKEELGDFSQTQSFEL*LTLIERGR 198
           N+NKK L  N L+   +E  EELGD  +T   +L L +  + R
Sbjct: 454 NQNKKNLLENWLAEDKLECSEELGDLVKTVDNDLALKIYIKAR 496


>At5g53350.1 68418.m06630 ATP-dependent Clp protease ATP-binding
           subunit ClpX1 (CLPX) identical to CLP protease
           regulatory subunit CLPX GI:2674203 from [Arabidopsis
           thaliana]
          Length = 579

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = -1

Query: 476 MHLLIKIEVSKETFQLTYLNSLNYFVANKIRTTKGVVAAP*TRPQKRRQTEF 321
           M   ++   S+ET  LT L+   YF+ N+I T +   + P    + +   +F
Sbjct: 1   MAAALRSNTSRETASLT-LSHFRYFIFNRIHTARTATSPPHCNHRSKSDEKF 51


>At1g11060.1 68414.m01267 expressed protein 
          Length = 930

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 255 RFFTNSIFRTLIDTYRTWPSLRTQNGGVTDR 163
           R  TN +     DTY T  S+ T+NG V+ R
Sbjct: 501 RKVTNEVVTISSDTYSTVGSISTRNGSVSQR 531


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,900,658
Number of Sequences: 28952
Number of extensions: 259487
Number of successful extensions: 418
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 414
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 418
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1633819784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).