SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0039
         (826 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g32030.1 68416.m04070 terpene synthase/cyclase family protein...    30   1.6  
At4g29280.1 68417.m04186 expressed protein ; expression supporte...    29   3.7  
At4g32200.1 68417.m04582 DNA-binding HORMA domain-containing pro...    29   5.0  
At4g20730.1 68417.m03013 filament protein-related similar to Cyt...    29   5.0  
At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c...    29   5.0  
At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related conta...    28   8.7  

>At3g32030.1 68416.m04070 terpene synthase/cyclase family protein
           contains Pfam profile: PF01397 terpene synthase family
          Length = 604

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = +3

Query: 6   FLNDKVIYLQNSNKNKLFELSGLSLKSCRHDFVTVESQTRA 128
           +L+   ++L+ S    LF    LSLK  +HDFV V++ T++
Sbjct: 15  YLHQAPLFLKTSQS--LFPRPSLSLKPMKHDFVCVKATTKS 53


>At4g29280.1 68417.m04186 expressed protein ; expression supported
           by MPSS
          Length = 77

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = +1

Query: 244 CMCEVYPGGVCNPSFCVCV*YRLKNGAG 327
           C   ++PG  C+PS CV   Y   NG G
Sbjct: 31  CTIIIHPGSPCDPSDCVQYCYAEYNGVG 58


>At4g32200.1 68417.m04582 DNA-binding HORMA domain-containing
           protein similar to meiotic asynaptic mutant 1
           [Arabidopsis thaliana] GI:7939627, aysnaptic 1 [Brassica
           oleracea var. alboglabra] GI:23506946; contains Pfam
           profile PF02301: HORMA domain
          Length = 1399

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 3/30 (10%)
 Frame = -3

Query: 362 SFFNRCHIWFDTPA---PFFNRYHTQTQKL 282
           ++F +CH+WF  P+    F NR H    +L
Sbjct: 760 AYFRQCHLWFPIPSLIISFLNRRHMAFSQL 789


>At4g20730.1 68417.m03013 filament protein-related similar to
           Cytadherence high molecular weight protein 2 (SP:P47460)
              [Mycoplasma genitalium]; similar to YEAST NUF1
           protein (Spindle poly body spacer protein SPC110)
           (SP:P32380) {Saccharomyces cerevisiae}; also
           SP|Q9UKX2|MYH2_HUMAN Myosin heavy chain, skeletal
           muscle, SP|P31732|OV71_ONCVO Muscle cell intermediate
           filament protein SP|P12882|MYH1_HUMAN Myosin heavy
           chain, skeletal muscle,. SP|Q17107|AV71_ACAVI Muscle
           cell intermediate filament protein
          Length = 800

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 3/30 (10%)
 Frame = -3

Query: 362 SFFNRCHIWFDTPA---PFFNRYHTQTQKL 282
           ++F +CH+WF  P+    F NR H    +L
Sbjct: 169 AYFRQCHLWFPIPSLIISFLNRRHMAFSQL 198


>At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein
           contains Pfam PF01422: NF-X1 type zinc finger; similar
           to transcriptional repressor NF-X1 (SP:Q12986) [Homo
           sapiens]; similar to EST gb|T21002
          Length = 1188

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +1

Query: 157 TVGCVECLAVNSSVFCNFGGLSMNGSWIFC 246
           T+ C  C  + ++V C+ GG S NGS ++C
Sbjct: 784 TITC-SCGRITATVPCDAGGRSANGSNVYC 812


>At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related contains
           weak similarity to 2-phosphoglycerate kinase (GI:467751)
           [Methanothermus fervidus]
          Length = 738

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = -2

Query: 330 HAGAVLQPVSHADAEARVTDAARVDLAHTEDPGAVH*QAAEVTEHATINS 181
           HAG  L PV+ A+++AR   A ++D    E   A     A+ T+   + S
Sbjct: 229 HAGEYLDPVAVAESKARRRRAKKMDSIEDEKAKASEGGKAKNTQQTDVGS 278


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,661,418
Number of Sequences: 28952
Number of extensions: 319788
Number of successful extensions: 756
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 733
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 756
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1892353600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).