SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0037
         (740 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g60410.2 68416.m06757 expressed protein                             29   2.4  
At3g60410.1 68416.m06756 expressed protein                             29   2.4  
At5g28250.1 68418.m03425 Ulp1 protease family protein contains P...    29   3.2  
At2g32620.1 68415.m03982 cellulose synthase family protein simil...    28   5.7  
At3g47210.1 68416.m05126 expressed protein contains Pfam profile...    28   7.5  
At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identica...    28   7.5  

>At3g60410.2 68416.m06757 expressed protein
          Length = 324

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 12/20 (60%), Positives = 12/20 (60%)
 Frame = +1

Query: 256 GPCTWAERPRLPPPVPDRHI 315
           GP TW  RPR PPP   R I
Sbjct: 196 GPKTWNLRPRRPPPTKKRSI 215


>At3g60410.1 68416.m06756 expressed protein
          Length = 324

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 12/20 (60%), Positives = 12/20 (60%)
 Frame = +1

Query: 256 GPCTWAERPRLPPPVPDRHI 315
           GP TW  RPR PPP   R I
Sbjct: 196 GPKTWNLRPRRPPPTKKRSI 215


>At5g28250.1 68418.m03425 Ulp1 protease family protein contains Pfam
           profile PF02902: Ulp1 protease family, C-terminal
           catalytic domain
          Length = 939

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = -2

Query: 196 ATNSASPGGTAADHLRAEPVPGDQQSGPQPT 104
           A N   P   AAD    E   GDQ+S P P+
Sbjct: 397 AGNGTKPNPEAADESNNETASGDQESNPPPS 427


>At2g32620.1 68415.m03982 cellulose synthase family protein similar
           to Zea mays cellulose synthase-5 [gi:9622882], -4
           [gi:9622880], -9 [gi:9622890]
          Length = 757

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 11/91 (12%)
 Frame = +3

Query: 48  NSYNDSIHVGFCRYESR----RAVGWGPDC*SPGTGS-----ARRW-SAAVPPGLAEFVA 197
           NS   +  VG C YES+    + +GW  D  S    +     +R W S+ + P    F+ 
Sbjct: 428 NSIEAAQEVGHCDYESQTSWGKTIGWLYDSMSEDMNTSIGIHSRGWTSSYIAPDPPAFLG 487

Query: 198 PLQRAGL-CLLAHQPHAVGAWTVYMGRASPL 287
            +   GL  ++  +  A G+  V   + SPL
Sbjct: 488 SMPPGGLEAMIQQRRWATGSIEVLFNKQSPL 518


>At3g47210.1 68416.m05126 expressed protein contains Pfam profile
           PF03140: Plant protein of unknown function
          Length = 474

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +2

Query: 545 GLKDGLAKLLYIQIVSGLSCLMSLLFSTRKLCLY 646
           GL+    +L+Y+ I+ G   LM LL  +RK+ LY
Sbjct: 170 GLEGSPHELVYMMILDGCFILMLLLIVSRKIELY 203


>At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identical
           to gi|3883122|gb|AAC77824; supported by cDNA
           gi|3883121|gb|AF082299
          Length = 131

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 16/59 (27%), Positives = 25/59 (42%)
 Frame = -2

Query: 277 ARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTA 101
           A P   V+ PT     +   SP      T++ +PG +A     + P PG   +   P+A
Sbjct: 50  ASPPVPVNEPTPAPTTSPTTSPVASPPQTDAPAPGPSAGLTPTSSPAPGPDGAADAPSA 108


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,327,673
Number of Sequences: 28952
Number of extensions: 312278
Number of successful extensions: 869
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 830
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 868
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1633819784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).