SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0036
         (830 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g19960.1 68417.m02923 potassium transporter family protein si...    29   5.0  
At1g12460.1 68414.m01440 leucine-rich repeat transmembrane prote...    29   5.0  
At5g17860.1 68418.m02093 cation exchanger, putative (CAX7) conta...    28   6.6  
At5g38590.2 68418.m04666 F-box family protein contains F-box dom...    28   8.7  
At5g38590.1 68418.m04667 F-box family protein contains F-box dom...    28   8.7  
At1g04190.1 68414.m00409 tetratricopeptide repeat (TPR)-containi...    28   8.7  
At1g02890.1 68414.m00256 AAA-type ATPase family protein contains...    28   8.7  

>At4g19960.1 68417.m02923 potassium transporter family protein
           similar to potassium transporter [Arabidopsis thaliana]
           gi|2654088|gb|AAB87687; KUP/HAK/KT Transporter family
           member, PMID:11500563; contains Pfam profile PF02705: K+
           potassium transporter
          Length = 842

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = -1

Query: 362 LSIYIKMNCCSLVSLKL-ENGWTDLANFGLELFVEVQRRFKSLKKYE 225
           LS +++++  S V  K+ E GW  L    + L V     + ++KKYE
Sbjct: 523 LSFFVELSYFSAVIFKIDEGGWVPLIIAAISLLVMSVWHYATVKKYE 569


>At1g12460.1 68414.m01440 leucine-rich repeat transmembrane protein
           kinase, putative
          Length = 882

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -1

Query: 293 LANFGLELFVEVQRRFKSLKKYENARNYI 207
           L+++GLE F+ V   F   KK+ NA  YI
Sbjct: 743 LSDYGLEKFLPVMDSFGLTKKFHNAVGYI 771


>At5g17860.1 68418.m02093 cation exchanger, putative (CAX7) contains
           similarity to SWISS-PROT:Q9HC58 NKX3_HUMAN
           Sodium/potassium/calcium exchanger 3 precursor {Homo
           sapiens}; Ca2+:Cation Antiporter (CaCA) Family member
           PMID:11500563
          Length = 570

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 2/30 (6%)
 Frame = +3

Query: 711 MFFSILTIMVPIFY--VYVMYVGFLIIAYF 794
           +F   +TI V + Y  +Y++YVGFL +++F
Sbjct: 225 IFIGKVTIWVALCYLSIYLLYVGFLSVSHF 254


>At5g38590.2 68418.m04666 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 410

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 511 WHGNSPNYYRSDLEQSVRLCVLRHEADSLGITHF 612
           +H NSP+    D+ + + + V RH  D L I HF
Sbjct: 80  FHSNSPDIKPEDIRRWIEIAVSRHVHD-LDIDHF 112


>At5g38590.1 68418.m04667 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 289

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 511 WHGNSPNYYRSDLEQSVRLCVLRHEADSLGITHF 612
           +H NSP+    D+ + + + V RH  D L I HF
Sbjct: 80  FHSNSPDIKPEDIRRWIEIAVSRHVHD-LDIDHF 112


>At1g04190.1 68414.m00409 tetratricopeptide repeat (TPR)-containing
           protein low similarity to protein antigen LmSTI1
           [Leishmania major] GI:1698880; contains Pfam profile
           PF00515 TPR Domain; EST gb|Z47802 and gb|Z48402 come
           from this gene
          Length = 328

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 88  VVPRSINKRPKLWYKINLKKYKRNPSDG 171
           V P+S    P++W  +  +K+K  P+DG
Sbjct: 249 VTPKSSISYPQVWKGVGSRKWKLGPNDG 276


>At1g02890.1 68414.m00256 AAA-type ATPase family protein contains Pfam
            domain, PF00004: ATPase, AAA family; similar to
            mitochondrial sorting protein 1 (MSP1) (TAT-binding
            homolog 4) (Swiss-Prot:P28737) [Saccharomyces cerevisiae]
          Length = 1252

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%)
 Frame = -1

Query: 284  FGLELFVEVQRRFKSLKKYENARNYIKTNNFVFPLMS---PPSD 162
            +GL+L  E+Q   KS KK  + ++ +  N F   L+S   PPSD
Sbjct: 903  YGLQLLHEIQNENKSTKK--SLKDVVTENEFEKKLLSDVIPPSD 944


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,141,220
Number of Sequences: 28952
Number of extensions: 351296
Number of successful extensions: 763
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 742
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 763
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1911862400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).