SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0035
         (754 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g18600.1 68417.m02755 expressed protein                             30   1.4  
At2g39630.1 68415.m04858 glycosyl transferase family 2 protein s...    29   3.3  
At5g15630.1 68418.m01829 phytochelatin synthetase family protein...    29   4.4  
At5g49110.1 68418.m06079 expressed protein  ; expression support...    28   5.8  
At5g23050.1 68418.m02695 acyl-activating enzyme 17 (AAE17) nearl...    28   5.8  

>At4g18600.1 68417.m02755 expressed protein
          Length = 1907

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = +1

Query: 124  LSIPTAV--DEMEKKELRTSATETGLNSKIGIRGTDRLEILSNVAVFDESLSDTG 282
            LS+  AV  +++   E  +S TET  ++K   R T   ++ S  AVFDE ++ +G
Sbjct: 1376 LSLKEAVFDEKIPGSEASSSTTETSPHNKTFPRETITTDLSSTEAVFDEKITGSG 1430



 Score = 28.7 bits (61), Expect = 4.4
 Identities = 23/84 (27%), Positives = 38/84 (45%)
 Frame = +1

Query: 115  EHTLSIPTAVDEMEKKELRTSATETGLNSKIGIRGTDRLEILSNVAVFDESLSDTGGREK 294
            E++L+     +++   E  TS TETG ++K        +E   N AVFDE +  +     
Sbjct: 1258 ENSLNEAVFDEKIPGSEASTSTTETGPHNKTFPEEPFAMENFLNEAVFDEKIPGSEAPVS 1317

Query: 295  CLLRAHKSVSLTEETGVLPMPTDL 366
                   + + TEE    P+ TD+
Sbjct: 1318 TTETGLHNETFTEE----PVATDI 1337


>At2g39630.1 68415.m04858 glycosyl transferase family 2 protein
           similar to dolichyl-phosphate beta-glucosyltransferase
           from Saccharomyces cerevisiae [SP|P40350]; contains Pfam
           glycosyltransferase group 2 domain PF00535
          Length = 336

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -3

Query: 323 DTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSV 180
           D +L  L K F++P V +S         K+S LS+P + ++EL+ +SV
Sbjct: 278 DVELVYLCKRFNIPMVEISVKWSEIPGSKVSMLSIPNM-LWELALMSV 324


>At5g15630.1 68418.m01829 phytochelatin synthetase family protein /
           COBRA cell expansion protein COBL4 similar to
           phytochelatin synthetase [Hordeum vulgare subsp.
           vulgare] GI:29570314; identified in Roudier, et al,
           Plant Phys. (2002) 130:538-548 (PMID:12376623); contains
           Pfam profile PF04833: Phytochelatin synthetase-like
           conserved region
          Length = 431

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 2/30 (6%)
 Frame = -3

Query: 707 VNNTDWSCILEHHNINDM--VNSFNYKVIS 624
           +N+T W+  ++H N+N++  V SF+YK +S
Sbjct: 305 MNHTLWTLAIQHPNLNNVTQVFSFDYKPVS 334


>At5g49110.1 68418.m06079 expressed protein  ; expression supported
           by MPSS
          Length = 1487

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 22/67 (32%), Positives = 35/67 (52%)
 Frame = -3

Query: 293 FSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCS 114
           FSLPP  LS SS  + L  + S S    P  ++S   +A +  S  S+S T     ++CS
Sbjct: 33  FSLPPYLLSPSSHDSLLSYLKSRSSSPSPSKQVSEYVIALL--SLISLSPTT---PSLCS 87

Query: 113 KMIALIL 93
            + +L++
Sbjct: 88  LLASLLI 94


>At5g23050.1 68418.m02695 acyl-activating enzyme 17 (AAE17) nearly
           identical to acyl-activating enzyme 17 [Arabidopsis
           thaliana] GI:29893266; similar to acetyl-CoA synthetase
           [SP|P27095] from Methanothrix soehngenii; contains Pfam
           AMP-binding enzyme domain PF00501; identical to cDNA
           acyl-activating enzyme 17 (At5g23050) GI:29893265
          Length = 721

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 1/28 (3%)
 Frame = +1

Query: 127 SIP-TAVDEMEKKELRTSATETGLNSKI 207
           S+P TA +++ ++ LR   T+TGLNSK+
Sbjct: 694 SLPRTATNKVMRRVLRQQLTQTGLNSKL 721


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,026,808
Number of Sequences: 28952
Number of extensions: 329670
Number of successful extensions: 892
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 875
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 892
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1672953192
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).