SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0034
         (840 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g15640.1 68415.m01791 F-box family protein contains Pfam PF00...    34   0.14 
At1g48540.2 68414.m05428 leucine-rich repeat family protein            30   2.2  
At1g48540.1 68414.m05427 leucine-rich repeat family protein            30   2.2  
At1g30760.1 68414.m03761 FAD-binding domain-containing protein s...    30   2.2  
At1g10830.1 68414.m01244 sodium symporter-related contains five ...    30   2.2  
At5g01280.1 68418.m00037 expressed protein                             29   3.8  
At1g76070.1 68414.m08834 expressed protein                             29   3.8  
At1g47410.1 68414.m05250 expressed protein identical to hypothet...    28   6.7  
At1g28300.1 68414.m03473 transcriptional factor B3 family protei...    28   6.7  
At4g25790.1 68417.m03711 allergen V5/Tpx-1-related family protei...    28   8.9  
At2g32040.1 68415.m03914 integral membrane transporter family pr...    28   8.9  
At1g19360.1 68414.m02409 expressed protein                             28   8.9  

>At2g15640.1 68415.m01791 F-box family protein contains Pfam
           PF00646: F-box domain; contains TIGRFAM TIGR01640 :
           F-box protein interaction domain
          Length = 426

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 15/59 (25%), Positives = 29/59 (49%)
 Frame = -1

Query: 348 WEDNNVIFKILNTEYEMYLKLDVNVDSYGDRKTWGSNGSSEKRHTWSLYPVKVGDQQLF 172
           WED+  I+K+  ++ + Y++ ++N D   + + W       K+  WS Y     D + F
Sbjct: 278 WEDDVDIYKLYYSDVDEYVEYNINDDDINELRVWVL--EDVKKQQWSKYAYTWTDDRFF 334


>At1g48540.2 68414.m05428 leucine-rich repeat family protein 
          Length = 1051

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/62 (24%), Positives = 31/62 (50%)
 Frame = -1

Query: 729 TSINNHLYNLVTGGDYINAVKTVRSLVDNQGSDVCRDVVSRLVSQGIKNTMSFAYKLWHE 550
           + ++ HL  LV   + +  ++ + +L   QG DV  +++S         ++S   +LW E
Sbjct: 232 SQVSCHLVKLVLRNNALTTLRGIENLKSLQGLDVSYNIISNFSELEFLWSLSQLKELWLE 291

Query: 549 GH 544
           G+
Sbjct: 292 GN 293


>At1g48540.1 68414.m05427 leucine-rich repeat family protein 
          Length = 1063

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/62 (24%), Positives = 31/62 (50%)
 Frame = -1

Query: 729 TSINNHLYNLVTGGDYINAVKTVRSLVDNQGSDVCRDVVSRLVSQGIKNTMSFAYKLWHE 550
           + ++ HL  LV   + +  ++ + +L   QG DV  +++S         ++S   +LW E
Sbjct: 232 SQVSCHLVKLVLRNNALTTLRGIENLKSLQGLDVSYNIISNFSELEFLWSLSQLKELWLE 291

Query: 549 GH 544
           G+
Sbjct: 292 GN 293


>At1g30760.1 68414.m03761 FAD-binding domain-containing protein
           similar to SP|P30986 reticuline oxidase precursor
           (Berberine-bridge-forming enzyme) (BBE)
           (Tetrahydroprotoberberine synthase) [Eschscholzia
           californica]; contains PF01565 FAD binding domain
          Length = 534

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 1/56 (1%)
 Frame = -1

Query: 405 WGDGKDYTSHHVSWQLISLWEDNNVIFKILNTEYEMYLKLDVNVDSYG-DRKTWGS 241
           W DGK   + H+ W           + K   + Y  Y  LD+ ++  G D + WG+
Sbjct: 445 WQDGKTSEAKHMGWMREMYSYMEQYVSKSPRSAYVNYRDLDLGMNGKGSDAREWGN 500


>At1g10830.1 68414.m01244 sodium symporter-related contains five
           transmembrane domains; Interpro IPR001991
           Sodium:dicarboxylate symporter; EST gb|F13926 comes from
           this gene
          Length = 367

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +2

Query: 701 KLYKWLLIDVASAKTIFVLNAVWVFKSAG 787
           KL  W+   V     +F+LN VW+  S G
Sbjct: 92  KLVSWVYFGVVLGVVLFILNVVWIDNSTG 120


>At5g01280.1 68418.m00037 expressed protein
          Length = 460

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 2/85 (2%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P    TS  TRAT TSS  TS   S S  ++   + ++ +T+  +       ST     G
Sbjct: 114 PTSRATSTTTRATLTSSSTTSSTRSWSRPSSSSGTGTSRVTLTAARATRPTTSTDQQTTG 173

Query: 401 ETEKT--TPATMSAGNSSLFGKTTT 333
               T      MSA NS    +++T
Sbjct: 174 SATSTRSNNRPMSAPNSKPGSRSST 198


>At1g76070.1 68414.m08834 expressed protein
          Length = 272

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = +1

Query: 514 AREVIFDDVLVALVPQLVRERHGVLDALRDEPRDDVATDVGAL 642
           A ++ F   +V LVP   R R    DA+ DEP     + +G +
Sbjct: 52  ANKMFFSGPMVPLVPNAARVRRNKSDAVWDEPTSPKVSCIGQI 94


>At1g47410.1 68414.m05250 expressed protein identical to
           hypothetical protein GB:AAD46041 GI:5668815 from
           (Arabidopsis thaliana)
          Length = 189

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 15/34 (44%), Positives = 16/34 (47%)
 Frame = +2

Query: 20  EGCHCHGWIMKP*YSGLSATVPLLPHTRRSPYES 121
           E CHC GW       GL     LLP   +SP ES
Sbjct: 146 EFCHCQGWPF-----GLGRKAALLPPLPKSPAES 174


>At1g28300.1 68414.m03473 transcriptional factor B3 family protein /
           leafy cotyledon 2 (LEC2) nearly identical to LEAFY
           COTYLEDON 2 [Arabidopsis thaliana] GI:15987516; contains
           Pfam profile PF02362: B3 DNA binding domain
          Length = 363

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 13/46 (28%), Positives = 24/46 (52%)
 Frame = -3

Query: 187 RPTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQPRVLRL 50
           +P  +    P +P  T+ G E G + G PC+ ++R     PR+ ++
Sbjct: 63  QPVYLSECYPQIPV-TQTGSEFGSLVGNPCLWQERGGFLDPRMTKM 107


>At4g25790.1 68417.m03711 allergen V5/Tpx-1-related family protein
           similar to SP|Q40374 Pathogenesis-related protein PR-1
           precursor {Medicago truncatula}; contains Pfam profile
           PF00188: SCP-like extracellular protein
          Length = 210

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = -1

Query: 444 LDANVGEYNDRLTWGDGKDYTS 379
           L  + G Y + L WG G D+TS
Sbjct: 117 LTHSTGPYGENLFWGSGSDFTS 138


>At2g32040.1 68415.m03914 integral membrane transporter family
           protein contains 9 transmembrane domains; contains Pfam
           PF03092: BT1 family; contains TIGRFAMS TIGR00788:
           folate/biopterin transporter; similar to high affinity
           folic acid/methotrexate transporter 5 (GI:21898554)
           [Leishmania tarentolae]
          Length = 560

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = +2

Query: 41  WIMKP*YSGLSATVPLLPHTRRS 109
           W++KP Y  +S +VPL  + RRS
Sbjct: 173 WLVKPLYGFISDSVPLFGYRRRS 195


>At1g19360.1 68414.m02409 expressed protein
          Length = 428

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 12/48 (25%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = -1

Query: 423 YNDRLTWGDGKDYTSHHVSWQLISLWE--DNNVIFKILNTEYEMYLKL 286
           +N+ L +    +YT+ H S +++ ++E  ++ V+FK +   +E+  K+
Sbjct: 341 FNEELFYPSHPEYTALHASKRVMDMYEFMNSKVLFKTVRKNHELKKKV 388


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,104,132
Number of Sequences: 28952
Number of extensions: 349286
Number of successful extensions: 1121
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1078
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1120
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1941125600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).