SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0031
         (644 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g05630.1 68415.m00599 autophagy 8d (APG8d) identical to autop...   159   1e-39
At4g16520.2 68417.m02501 autophagy 8f (APG8f) identical to autop...   154   4e-38
At4g16520.1 68417.m02500 autophagy 8f (APG8f) identical to autop...   154   4e-38
At2g45170.2 68415.m05624 autophagy 8e (APG8e) identical to autop...   153   1e-37
At2g45170.1 68415.m05623 autophagy 8e (APG8e) identical to autop...   153   1e-37
At3g60640.1 68416.m06785 autophagy 8g (APG8g) identical to autop...   152   2e-37
At4g21980.1 68417.m03182 autophagy 8a (APG8a) identical to autop...   146   1e-35
At4g04620.2 68417.m00676 autophagy 8b (APG8b) identical to autop...   144   3e-35
At4g04620.1 68417.m00675 autophagy 8b (APG8b) identical to autop...   144   3e-35
At1g62040.1 68414.m06997 autophagy 8c (APG8c) identical to autop...   144   3e-35
At3g15580.1 68416.m01974 autophagy 8i (APG8i) identical to autop...   122   3e-28
At3g06420.1 68416.m00740 autophagy 8h (APG8h) identical to autop...   118   4e-27
At5g06680.1 68418.m00754 tubulin family protein similar to SP|Q9...    30   1.1  
At3g01015.1 68416.m00001 expressed protein ; expression supporte...    29   3.5  
At4g19080.1 68417.m02813 hypothetical protein contains Pfam doma...    28   4.6  
At1g49050.1 68414.m05500 aspartyl protease family protein contai...    28   4.6  
At5g54830.1 68418.m06829 DOMON domain-containing protein / dopam...    28   6.1  

>At2g05630.1 68415.m00599 autophagy 8d (APG8d) identical to
           autophagy 8d [Arabidopsis thaliana] GI:19912157;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3
          Length = 120

 Score =  159 bits (387), Expect = 1e-39
 Identities = 67/112 (59%), Positives = 91/112 (81%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           +K EH  EKR+AE  +IR KYPDR+PVIVE+A K+ + D+D+KKYLVP+DLTVGQF +++
Sbjct: 6   FKHEHPLEKRQAEAARIREKYPDRIPVIVERAEKSDVPDIDRKKYLVPADLTVGQFVYVV 65

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           RKRI L PE A+F FV N++PPT+A M ++Y+EH DED FLY+++S EN +G
Sbjct: 66  RKRIKLSPEKAIFIFVKNILPPTAAIMSAIYEEHKDEDGFLYMSYSGENTFG 117


>At4g16520.2 68417.m02501 autophagy 8f (APG8f) identical to
           autophagy 8f [Arabidopsis thaliana] GI:19912161;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3
          Length = 121

 Score =  154 bits (374), Expect = 4e-38
 Identities = 68/115 (59%), Positives = 88/115 (76%)
 Frame = +2

Query: 47  KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 226
           K  +K+EH  EKR+AE  +IR KYPDR+PVIVEKA K+ +  +DKKKYLVP+DLTVGQF 
Sbjct: 3   KSSFKQEHDLEKRRAEAARIREKYPDRIPVIVEKAEKSDIPTIDKKKYLVPADLTVGQFV 62

Query: 227 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           ++IRKRI L  E A+F FV+NV+PP  A M S+Y+E  D+D FLY+ +S EN +G
Sbjct: 63  YVIRKRIKLSAEKAIFIFVDNVLPPAGALMSSVYEEKKDDDGFLYVTYSGENTFG 117


>At4g16520.1 68417.m02500 autophagy 8f (APG8f) identical to
           autophagy 8f [Arabidopsis thaliana] GI:19912161;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3
          Length = 121

 Score =  154 bits (374), Expect = 4e-38
 Identities = 68/115 (59%), Positives = 88/115 (76%)
 Frame = +2

Query: 47  KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 226
           K  +K+EH  EKR+AE  +IR KYPDR+PVIVEKA K+ +  +DKKKYLVP+DLTVGQF 
Sbjct: 3   KSSFKQEHDLEKRRAEAARIREKYPDRIPVIVEKAEKSDIPTIDKKKYLVPADLTVGQFV 62

Query: 227 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           ++IRKRI L  E A+F FV+NV+PP  A M S+Y+E  D+D FLY+ +S EN +G
Sbjct: 63  YVIRKRIKLSAEKAIFIFVDNVLPPAGALMSSVYEEKKDDDGFLYVTYSGENTFG 117


>At2g45170.2 68415.m05624 autophagy 8e (APG8e) identical to
           autophagy 8e [Arabidopsis thaliana] GI:19912159;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3
          Length = 122

 Score =  153 bits (370), Expect = 1e-37
 Identities = 69/112 (61%), Positives = 87/112 (77%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           +K +  FEKRKAE  +IR KYPDR+PVIVEKA K+ + ++DKKKYLVPSDLTVGQF ++I
Sbjct: 7   FKMDDDFEKRKAEAGRIREKYPDRIPVIVEKAEKSEVPNIDKKKYLVPSDLTVGQFVYVI 66

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           RKRI L  E A+F FV+NV+PPT   M S+Y++  DED FLYI +S EN +G
Sbjct: 67  RKRIKLSAEKAIFIFVDNVLPPTGELMSSVYEDKKDEDGFLYITYSGENTFG 118


>At2g45170.1 68415.m05623 autophagy 8e (APG8e) identical to
           autophagy 8e [Arabidopsis thaliana] GI:19912159;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3
          Length = 122

 Score =  153 bits (370), Expect = 1e-37
 Identities = 69/112 (61%), Positives = 87/112 (77%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           +K +  FEKRKAE  +IR KYPDR+PVIVEKA K+ + ++DKKKYLVPSDLTVGQF ++I
Sbjct: 7   FKMDDDFEKRKAEAGRIREKYPDRIPVIVEKAEKSEVPNIDKKKYLVPSDLTVGQFVYVI 66

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           RKRI L  E A+F FV+NV+PPT   M S+Y++  DED FLYI +S EN +G
Sbjct: 67  RKRIKLSAEKAIFIFVDNVLPPTGELMSSVYEDKKDEDGFLYITYSGENTFG 118


>At3g60640.1 68416.m06785 autophagy 8g (APG8g) identical to
           autophagy 8g [Arabidopsis thaliana] GI:19912163;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3; supporting cDNA
           gi|19912162|dbj|AB073181.1|
          Length = 121

 Score =  152 bits (368), Expect = 2e-37
 Identities = 66/113 (58%), Positives = 90/113 (79%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           ++++H FEKRKAE  +IR KY DRVPVIVEK+ K+ + ++DKKKYLVP+DLTVGQF ++I
Sbjct: 6   FRQDHDFEKRKAEALRIREKYSDRVPVIVEKSEKSDIPNIDKKKYLVPADLTVGQFVYVI 65

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 394
           RKRI L  E A+F FV+NV+PPT A M ++Y E+ +ED FLY+ +S EN +G+
Sbjct: 66  RKRIQLSAEKAIFIFVDNVLPPTGAMMSTIYDENKEEDGFLYVTYSGENTFGS 118


>At4g21980.1 68417.m03182 autophagy 8a (APG8a) identical to
           autophagy 8a [Arabidopsis thaliana] GI:19912151;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3
          Length = 122

 Score =  146 bits (353), Expect = 1e-35
 Identities = 64/116 (55%), Positives = 87/116 (75%)
 Frame = +2

Query: 47  KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 226
           K  +K  +  E R +E  +IR KYPDR+PVIVEKA ++ + D+DKKKYLVP+DLTVGQF 
Sbjct: 3   KSSFKISNPLEARMSESSRIREKYPDRIPVIVEKAGQSDVPDIDKKKYLVPADLTVGQFV 62

Query: 227 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 394
           +++RKRI L  E A+F FV N +PPT+A M ++Y+EH DED FLY+ +S EN +G+
Sbjct: 63  YVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFGS 118


>At4g04620.2 68417.m00676 autophagy 8b (APG8b) identical to
           autophagy 8b [Arabidopsis thaliana] GI:19912153;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3
          Length = 122

 Score =  144 bits (350), Expect = 3e-35
 Identities = 65/118 (55%), Positives = 87/118 (73%)
 Frame = +2

Query: 47  KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 226
           K  +K  +  E R AE  +IR KYP+RVPVIVEKA ++ + D+DKKKYLVP+DLT+GQF 
Sbjct: 3   KNSFKLSNPLEMRMAESTRIRAKYPERVPVIVEKAGQSDVPDIDKKKYLVPADLTIGQFV 62

Query: 227 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN*F 400
           +++RKRI L  E A+F FV N +PPT+A M ++Y+EH DED FLY+ +S EN +G  F
Sbjct: 63  YVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFGGSF 120


>At4g04620.1 68417.m00675 autophagy 8b (APG8b) identical to
           autophagy 8b [Arabidopsis thaliana] GI:19912153;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3
          Length = 122

 Score =  144 bits (350), Expect = 3e-35
 Identities = 65/118 (55%), Positives = 87/118 (73%)
 Frame = +2

Query: 47  KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 226
           K  +K  +  E R AE  +IR KYP+RVPVIVEKA ++ + D+DKKKYLVP+DLT+GQF 
Sbjct: 3   KNSFKLSNPLEMRMAESTRIRAKYPERVPVIVEKAGQSDVPDIDKKKYLVPADLTIGQFV 62

Query: 227 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN*F 400
           +++RKRI L  E A+F FV N +PPT+A M ++Y+EH DED FLY+ +S EN +G  F
Sbjct: 63  YVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFGGSF 120


>At1g62040.1 68414.m06997 autophagy 8c (APG8c) identical to
           autophagy 8c [Arabidopsis thaliana] GI:19912155;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3
          Length = 119

 Score =  144 bits (350), Expect = 3e-35
 Identities = 62/112 (55%), Positives = 86/112 (76%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           +K EH  E+R+ E  +IR KYPDR+PVIVE+A ++ + ++DKKKYLVP+DLTVGQF +++
Sbjct: 6   FKLEHPLERRQIESSRIREKYPDRIPVIVERAERSDVPNIDKKKYLVPADLTVGQFVYVV 65

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           RKRI L  E A+F FV N +PPT+A M ++Y E+ DED FLY+ +S EN +G
Sbjct: 66  RKRIKLSAEKAIFVFVKNTLPPTAAMMSAIYDENKDEDGFLYMTYSGENTFG 117


>At3g15580.1 68416.m01974 autophagy 8i (APG8i) identical to
           autophagy 8i [Arabidopsis thaliana] GI:19912167;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3; supporting cDNA
           gi|21636957|gb|AF492760.1|
          Length = 115

 Score =  122 bits (293), Expect = 3e-28
 Identities = 52/112 (46%), Positives = 79/112 (70%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           +KE+++ ++R AE  +I  KYP R+PVI EK  K  L  ++KKK+LVP D++VGQF +++
Sbjct: 4   FKEQYTLDERLAESREIIAKYPTRIPVIAEKYCKTDLPAIEKKKFLVPRDMSVGQFIYIL 63

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
             R+HL P  ALF FVNN +P T+A M S+Y+ + D+D F+Y+ +S E  +G
Sbjct: 64  SARLHLSPGKALFVFVNNTLPQTAALMDSVYESYKDDDGFVYMCYSSEKTFG 115


>At3g06420.1 68416.m00740 autophagy 8h (APG8h) identical to
           autophagy 8h [Arabidopsis thaliana] GI:19912165;
           contains Pfam profile PF02991: Microtubule associated
           protein 1A/1B, light chain 3; supporting cDNA
           gi|19912164|dbj|AB073182.1|
          Length = 119

 Score =  118 bits (283), Expect = 4e-27
 Identities = 53/112 (47%), Positives = 74/112 (66%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           +K++ S ++R  E   I  KYPDR+PVI+EK   A L D++K KYLVP D+TVG F  ++
Sbjct: 8   FKDQFSSDERLKESNNIIAKYPDRIPVIIEKYSNADLPDMEKNKYLVPRDMTVGHFIHML 67

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            KR+ L P  ALF FV+N +P T++ M SLY    +ED FLY+ +S E  +G
Sbjct: 68  SKRMQLDPSKALFVFVHNTLPQTASRMDSLYNTFKEEDGFLYMCYSTEKTFG 119


>At5g06680.1 68418.m00754 tubulin family protein similar to
           SP|Q96CW5 Gamma-tubulin complex component 3 {Homo
           sapiens}
          Length = 838

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +1

Query: 385 LWKLI-PNYSLSNSFTLSDHMVKFNLSLRLKLCIILW 492
           +WK + PN   SNSF      VK  L   L+ C +LW
Sbjct: 622 IWKTMKPNCITSNSFVKLQSSVKLQLLSALRRCQVLW 658


>At3g01015.1 68416.m00001 expressed protein ; expression supported
           by MPSS
          Length = 488

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +2

Query: 38  INMKFQYKEEHSFEKRKAEGEKIRRKYPDRVP 133
           IN+  QYK E   +++ AE E+IRR   + VP
Sbjct: 396 INLVEQYKTERERQQKLAEEEEIRRLRKELVP 427


>At4g19080.1 68417.m02813 hypothetical protein contains Pfam domain,
           PF04578: Protein of unknown function, DUF594
          Length = 327

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 18/63 (28%), Positives = 32/63 (50%)
 Frame = +1

Query: 346 RFLFIHSIFRRKCLWKLIPNYSLSNSFTLSDHMVKFNLSLRLKLCIILWYFFYY*LAYNT 525
           R L+   +F R CL   + NY L   F++SD + +   + R +L   LW F +  + + +
Sbjct: 13  RTLYPFRLFIRFCLGIPLINYLLE-FFSISDQVNEIVFTSRTRLTKELWEFIFEEVKHRS 71

Query: 526 IFV 534
           + V
Sbjct: 72  LLV 74


>At1g49050.1 68414.m05500 aspartyl protease family protein contains
           Pfam PF00026: Eukaryotic aspartyl protease; contains
           similarity to nucellin GI:2290203 from [Hordeum vulgare]
          Length = 583

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +2

Query: 176 DKKKYLVPSDLTVGQFYFLIRKRIHLRPEDAL 271
           D KK+  P  L +G  + +I +++ ++PED L
Sbjct: 485 DVKKFFRPITLQIGSKWLIISRKLLIQPEDYL 516


>At5g54830.1 68418.m06829 DOMON domain-containing protein / dopamine
           beta-monooxygenase N-terminal domain-containing protein
           contains Pfam PF03351: DOMON domain
          Length = 907

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 5/39 (12%)
 Frame = +1

Query: 352 LFIHSIFRRKCLWKL-IPNYSLS----NSFTLSDHMVKF 453
           L+ HSIF+ K  WK+ + +  LS    NS  L D  VKF
Sbjct: 490 LYYHSIFQEKMGWKVQVVDGGLSDMYNNSVNLDDQQVKF 528


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,248,565
Number of Sequences: 28952
Number of extensions: 275242
Number of successful extensions: 759
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 735
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 759
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1334473344
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).