SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0028
         (956 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g22910.1 68417.m03309 WD-40 repeat family protein contains 6 ...    31   0.86 
At5g46210.1 68418.m05686 cullin, putative similar to SP|Q13619 C...    30   2.0  
At2g25320.1 68415.m03029 meprin and TRAF homology domain-contain...    29   4.6  
At1g06510.1 68414.m00690 expressed protein                             29   4.6  

>At4g22910.1 68417.m03309 WD-40 repeat family protein contains 6
           WD-40 repeats (PF00400); similar to fizzy-related
           protein (GI:5813825) Drosophila melanogaster,
           PID:g2326419;
          Length = 518

 Score = 31.5 bits (68), Expect = 0.86
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = -2

Query: 445 PRLSSCIVGSKSSSTGRLRPSMSDPFAPFITAYNTLKINSKSVCSPSFSSI 293
           P  S+ I  S SSS   L P+M+ P     +  N L IN+    SPS SS+
Sbjct: 6   PTASNVITNSNSSSMRNLSPAMNTPVVSLESRINRL-INANQSQSPSPSSL 55


>At5g46210.1 68418.m05686 cullin, putative similar to SP|Q13619
           Cullin homolog 4A (CUL-4A) {Homo sapiens}; contains Pfam
           profile PF00888: Cullin family
          Length = 792

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 1/85 (1%)
 Frame = +3

Query: 240 SLLLCLAEFAVRCGPQYLM-EEKDGEQTLLLLIFKVLYAVMKGANGSDIEGLSLPVDDDF 416
           SL   L+ +  + G + +M EEKD +    LL FK    ++   +    E     + D F
Sbjct: 367 SLRQALSSYVRKTGQKIVMDEEKDKDMVQSLLDFKASLDIIWEESFYKNESFGNTIKDSF 426

Query: 417 DPTIQLDNLGPKTIPASTIDVKLWA 491
           +  I L    P  + A  +D KL A
Sbjct: 427 EHLINLRQNRPAELIAKFLDEKLRA 451


>At2g25320.1 68415.m03029 meprin and TRAF homology domain-containing
            protein / MATH domain-containing protein weak similarity
            to  ubiquitin-specific protease 12 [Arabidopsis thaliana]
            GI:11993471; contains Pfam profile PF00917: MATH domain
          Length = 1663

 Score = 29.1 bits (62), Expect = 4.6
 Identities = 18/53 (33%), Positives = 27/53 (50%)
 Frame = +3

Query: 12   CPRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIR 170
            C  LP  V  + + L    K++   VS C+L   DY  + V  +PG+A  I+R
Sbjct: 1073 CQHLPEAVNAVRERL----KSLGADVSLCVL---DYLSKTVHSWPGIAEMILR 1118


>At1g06510.1 68414.m00690 expressed protein
          Length = 277

 Score = 29.1 bits (62), Expect = 4.6
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = +2

Query: 512 GTVPRALASMERMPTVLSCFRATRQS 589
           G VP  +A   R+PT L CF AT  S
Sbjct: 7   GGVPVVIAQSRRIPTSLRCFSATANS 32


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,572,179
Number of Sequences: 28952
Number of extensions: 438922
Number of successful extensions: 1220
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1162
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1220
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2304931176
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).