SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0026
         (744 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g14710.1 68418.m01725 expressed protein                             29   2.5  
At4g29460.1 68417.m04205 phospholipase A2 gamma, secretory low m...    29   2.5  
At2g29000.1 68415.m03527 leucine-rich repeat family protein / pr...    29   2.5  
At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family...    29   3.3  
At1g07560.1 68414.m00809 leucine-rich repeat protein kinase, put...    29   3.3  
At5g64470.2 68418.m08100 expressed protein similar to unknown pr...    27   9.9  
At5g64470.1 68418.m08099 expressed protein similar to unknown pr...    27   9.9  
At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, put...    27   9.9  
At1g67325.1 68414.m07663 zinc finger (Ran-binding) family protei...    27   9.9  
At1g55580.1 68414.m06361 scarecrow transcription factor family p...    27   9.9  

>At5g14710.1 68418.m01725 expressed protein
          Length = 124

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = -3

Query: 604 NKTFLVWCNEEDHLRIISMQMG 539
           NKT +V C+ EDH+ II+ Q+G
Sbjct: 22  NKTEIVICSYEDHILIIATQIG 43


>At4g29460.1 68417.m04205 phospholipase A2 gamma, secretory low
           molecular weight identical to secretory low molecular
           weight phospholipase A2 gamma [Arabidopsis thaliana]
           GI:26006457; contains INTERPRO domain IPR001211
           phospholipase A2
          Length = 187

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 11/33 (33%), Positives = 21/33 (63%)
 Frame = -3

Query: 520 YKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNL 422
           +K+    VN++ K I  S+ +++GF T CP ++
Sbjct: 87  HKQFKRCVNKLSKSIKHSNGEKIGFSTQCPYSI 119


>At2g29000.1 68415.m03527 leucine-rich repeat family protein /
           protein kinase family protein contains Pfam domains
           PF00560: Leucine Rich Repeat and PF00069: Protein kinase
           domain
          Length = 872

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%)
 Frame = -3

Query: 613 HNENKTFLV-WCNEEDHLRII-SMQMGGDLQQ 524
           H+ N   LV +CNEEDHL ++      GDL+Q
Sbjct: 617 HHTNLVNLVGYCNEEDHLALVYEYAANGDLKQ 648


>At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family
           protein contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 589

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = -2

Query: 533 PAAGVQEAGERRQRDREEDPVLAPRPARLPHVLPDQPGHHGP 408
           P A  Q+     Q ++ + P   P P+  P ++PD P H GP
Sbjct: 53  PHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPPRHQGP 94


>At1g07560.1 68414.m00809 leucine-rich repeat protein kinase,
           putative similar to light repressible receptor protein
           kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376;
           contains leucine rich repeat (LRR) domains,
           Pfam:PF00560; contains protein kinase domain,
           Pfam:PF00069
          Length = 856

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = -3

Query: 619 IYHNENKTFLVWCNEEDHLRIISMQM-GGDLQQ 524
           +YH    + + +C+E+DHL +I   M  GDL++
Sbjct: 606 VYHTNLVSLVGYCDEKDHLALIYQYMVNGDLKK 638


>At5g64470.2 68418.m08100 expressed protein similar to unknown
           protein (gb|AAD15463.1)
          Length = 407

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = -1

Query: 156 VYLFIVPRRPGTSQRAAPPPLLLFIVKRIFYKE 58
           ++  ++ RRP TS  A+PPP  LF  + +F  E
Sbjct: 35  LFYSLILRRPITSNIASPPPCDLFSGRWVFNPE 67


>At5g64470.1 68418.m08099 expressed protein similar to unknown
           protein (gb|AAD15463.1)
          Length = 325

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = -1

Query: 156 VYLFIVPRRPGTSQRAAPPPLLLFIVKRIFYKE 58
           ++  ++ RRP TS  A+PPP  LF  + +F  E
Sbjct: 35  LFYSLILRRPITSNIASPPPCDLFSGRWVFNPE 67


>At2g28970.1 68415.m03524 leucine-rich repeat protein kinase,
           putative similar to light repressible receptor protein
           kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376;
           contains leucine rich repeat (LRR) domains,
           Pfam:PF00560; contains protein kinase domain,
           Pfam:PF00069
          Length = 786

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 2/32 (6%)
 Frame = -3

Query: 613 HNENKTFLV-WCNEEDHLRIISMQM-GGDLQQ 524
           H++N   LV +C+E DHL +I   M  GDL+Q
Sbjct: 531 HHKNLVSLVGYCDEGDHLALIYEYMPNGDLKQ 562


>At1g67325.1 68414.m07663 zinc finger (Ran-binding) family protein
           similar to ZIS2 [Homo sapiens] GI:4191329; contains Pfam
           profile PF00641: Zn-finger in Ran binding protein and
           others
          Length = 288

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 11/20 (55%), Positives = 12/20 (60%)
 Frame = -2

Query: 716 PAAAHRRPLPVQGGRPLHAG 657
           PA AH RPL + G  P H G
Sbjct: 124 PAGAHYRPLHMSGPPPYHGG 143


>At1g55580.1 68414.m06361 scarecrow transcription factor family
           protein contains Pfam profile PF03514: GRAS family
           transcription factor
          Length = 445

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = +3

Query: 480 FFSISLTALTSLLYTCCRSPPICIEMMRRWSSSLHHTRNVLFS 608
           F S S ++  +   T    PP+CI      +S+ HH R +LF+
Sbjct: 5   FKSSSSSSEDATATTTENPPPLCIASSSAATSASHHLRRLLFT 47


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,722,114
Number of Sequences: 28952
Number of extensions: 192739
Number of successful extensions: 672
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 637
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 672
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1643603136
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).