SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0024
         (892 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g23410.1 68414.m02932 ubiquitin extension protein, putative /...   177   6e-45
At2g47110.1 68415.m05883 ubiquitin extension protein 6 (UBQ6) / ...   175   2e-44
At3g62250.1 68416.m06993 ubiquitin extension protein 5 (UBQ5) / ...   175   3e-44
At5g20620.1 68418.m02449 polyubiquitin (UBQ4) identical to GI:17677   106   2e-23
At5g03240.2 68418.m00273 polyubiquitin (UBQ3) identical to GI:92...   106   2e-23
At5g03240.1 68418.m00272 polyubiquitin (UBQ3) identical to GI:92...   106   2e-23
At4g05320.5 68417.m00814 polyubiquitin (UBQ10) (SEN3) senescence...   106   2e-23
At4g05320.4 68417.m00813 polyubiquitin (UBQ10) (SEN3) senescence...   106   2e-23
At4g05320.3 68417.m00812 polyubiquitin (UBQ10) (SEN3) senescence...   106   2e-23
At4g05320.2 68417.m00811 polyubiquitin (UBQ10) (SEN3) senescence...   106   2e-23
At4g05320.1 68417.m00810 polyubiquitin (UBQ10) (SEN3) senescence...   106   2e-23
At4g05050.1 68417.m00744 polyubiquitin (UBQ11) identical to GI:3...   106   2e-23
At4g02890.3 68417.m00391 polyubiquitin (UBQ14) identical to GI:1...   106   2e-23
At4g02890.2 68417.m00390 polyubiquitin (UBQ14) identical to GI:1...   106   2e-23
At4g02890.1 68417.m00389 polyubiquitin (UBQ14) identical to GI:1...   106   2e-23
At3g52590.1 68416.m05792 ubiquitin extension protein 1 (UBQ1) / ...   106   2e-23
At2g36170.1 68415.m04439 ubiquitin extension protein 2 (UBQ2) / ...   106   2e-23
At2g35635.1 68415.m04370 ubiquitin family protein contains INTER...   106   2e-23
At1g65350.1 68414.m07413 polyubiquitin, putative similar to poly...   106   2e-23
At1g31340.1 68414.m03835 ubiquitin family protein contains INTER...   106   2e-23
At1g55060.1 68414.m06289 polyubiquitin (UBQ12) identical to poly...   105   4e-23
At5g37640.1 68418.m04533 polyubiquitin (UBQ9) identical to polyu...   105   5e-23
At3g09790.1 68416.m01163 polyubiquitin (UBQ8) identical to polyu...   100   1e-21
At1g53930.1 68414.m06139 ubiquitin family protein contains Pfam ...    89   3e-18
At1g11980.1 68414.m01384 ubiquitin family protein similar to Cha...    68   1e-11
At5g42220.1 68418.m05139 ubiquitin family protein contains INTER...    52   5e-07
At2g17200.1 68415.m01986 ubiquitin family protein weak similarit...    50   2e-06
At2g17190.1 68415.m01985 ubiquitin family protein contains INTER...    50   2e-06
At1g53950.1 68414.m06145 ubiquitin family protein contains INTER...    47   2e-05
At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative simi...    46   3e-05
At4g02970.1 68417.m00404 ubiquitin family protein contains INTER...    39   0.005
At5g11080.1 68418.m01294 ubiquitin family protein contains INTER...    38   0.007
At4g03350.1 68417.m00457 ubiquitin family protein contains INTER...    38   0.007
At4g03370.1 68417.m00459 ubiquitin family protein contains INTER...    38   0.009
At3g13235.1 68416.m01666 ubiquitin family protein contains INTER...    38   0.009
At1g79650.3 68414.m09289 DNA repair protein RAD23, putative simi...    37   0.016
At1g79650.2 68414.m09288 DNA repair protein RAD23, putative simi...    37   0.016
At1g79650.1 68414.m09287 DNA repair protein RAD23, putative simi...    37   0.016
At1g16190.1 68414.m01939 DNA repair protein RAD23, putative simi...    37   0.016
At2g46500.2 68415.m05791 phosphatidylinositol 3- and 4-kinase fa...    37   0.021
At2g46500.1 68415.m05790 phosphatidylinositol 3- and 4-kinase fa...    37   0.021
At3g19040.1 68416.m02418 ubiquitin family protein / DNA-binding ...    36   0.036
At4g01000.1 68417.m00135 ubiquitin family protein low similarity...    33   0.19 
At5g14360.1 68418.m01678 ubiquitin family protein contains INTER...    33   0.25 
At4g05230.1 68417.m00789 ubiquitin family protein contains INTER...    33   0.34 
At1g32750.1 68414.m04038 HAC13 protein (HAC13) identical to HAC1...    33   0.34 
At4g03360.1 68417.m00458 ubiquitin family protein contains INTER...    31   0.78 
At4g02950.1 68417.m00402 ubiquitin family protein contains INTER...    31   0.78 
At4g05250.1 68417.m00793 ubiquitin family protein contains INTER...    30   1.8  
At5g24240.1 68418.m02852 phosphatidylinositol 3- and 4-kinase fa...    30   2.4  
At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal...    30   2.4  
At1g22050.1 68414.m02758 ubiquitin family protein contains INTER...    30   2.4  
At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp...    30   2.4  
At5g40630.1 68418.m04932 ubiquitin family protein contains INTER...    29   3.1  
At2g12550.1 68415.m01357 ubiquitin-associated (UBA)/TS-N domain-...    29   3.1  
At3g14150.1 68416.m01789 (S)-2-hydroxy-acid oxidase, peroxisomal...    29   4.1  
At1g47680.1 68414.m05297 hypothetical protein                          29   4.1  
At5g12280.1 68418.m01444 hypothetical protein                          29   5.5  
At3g11760.1 68416.m01443 expressed protein                             28   7.2  
At1g19980.1 68414.m02503 cytomatrix protein-related contains wea...    28   7.2  
At4g18360.1 68417.m02723 (S)-2-hydroxy-acid oxidase, peroxisomal...    28   9.6  

>At1g23410.1 68414.m02932 ubiquitin extension protein, putative /
           40S ribosomal protein S27A (RPS27aA) strong similarity
           to ubiquitin extension protein (UBQ5) GB:AAA32906
           GI:166934 from (Arabidopsis thaliana)
          Length = 156

 Score =  177 bits (432), Expect = 6e-45
 Identities = 88/139 (63%), Positives = 99/139 (71%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV      
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K Y+ P          KLAVL+FYKVD +GK+ RL++EC    CG G FMA   
Sbjct: 77  AKKRKKKTYTKPKKIKHTHKKVKLAVLQFYKVDGSGKVQRLKKECPSVSCGPGTFMASHF 136

Query: 531 DRHYCGKCHSTMVFKDDDK 475
           DRHYCGKC +T VFK  D+
Sbjct: 137 DRHYCGKCGTTYVFKKADE 155


>At2g47110.1 68415.m05883 ubiquitin extension protein 6 (UBQ6) / 40S
           ribosomal protein S27A (RPS27aB) identical to GI:166936
          Length = 157

 Score =  175 bits (427), Expect = 2e-44
 Identities = 87/137 (63%), Positives = 98/137 (71%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV      
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K Y+ P          KLAVL+FYKVD +GK+ RLR+EC    CGAG FMA   
Sbjct: 77  AKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHF 136

Query: 531 DRHYCGKCHSTMVFKDD 481
           DRHYCGKC  T V++ +
Sbjct: 137 DRHYCGKCGLTYVYQKE 153


>At3g62250.1 68416.m06993 ubiquitin extension protein 5 (UBQ5) / 40S
           ribosomal protein S27A (RPS27aC) identical to GI:166933,
           GI:166934
          Length = 157

 Score =  175 bits (426), Expect = 3e-44
 Identities = 86/137 (62%), Positives = 98/137 (71%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV      
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K Y+ P          KLAVL+FYK+D +GK+ RLR+EC    CGAG FMA   
Sbjct: 77  AKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKIDGSGKVQRLRKECPNATCGAGTFMASHF 136

Query: 531 DRHYCGKCHSTMVFKDD 481
           DRHYCGKC  T V++ +
Sbjct: 137 DRHYCGKCGLTYVYQKE 153


>At5g20620.1 68418.m02449 polyubiquitin (UBQ4) identical to GI:17677
          Length = 382

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 298



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 321 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 374


>At5g03240.2 68418.m00273 polyubiquitin (UBQ3) identical to
           GI:928809
          Length = 306

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 298


>At5g03240.1 68418.m00272 polyubiquitin (UBQ3) identical to
           GI:928809
          Length = 306

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 298


>At4g05320.5 68417.m00814 polyubiquitin (UBQ10) (SEN3)
           senescence-associated protein; identical to GI:870791
          Length = 312

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score = 35.5 bits (78), Expect = 0.048
 Identities = 16/18 (88%), Positives = 17/18 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKE 838
           VE SDTI+NVKAKIQDKE
Sbjct: 245 VESSDTIDNVKAKIQDKE 262



 Score = 31.9 bits (69), Expect = 0.59
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = -3

Query: 860 KLKFKTKRESLPINKG*SLLESSWKMDVPSRTTISRRNPPSTWC*GFVV 714
           K K + K   L  +   S LESS +MDV   TT SRR+   TW   FVV
Sbjct: 255 KAKIQDKEVFLRTSSVSSSLESSLRMDVLWPTTTSRRSLLFTWSCVFVV 303


>At4g05320.4 68417.m00813 polyubiquitin (UBQ10) (SEN3)
           senescence-associated protein; identical to GI:870791
          Length = 464

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 298



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 321 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 374



 Score = 35.5 bits (78), Expect = 0.048
 Identities = 16/18 (88%), Positives = 17/18 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKE 838
           VE SDTI+NVKAKIQDKE
Sbjct: 397 VESSDTIDNVKAKIQDKE 414



 Score = 31.9 bits (69), Expect = 0.59
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = -3

Query: 860 KLKFKTKRESLPINKG*SLLESSWKMDVPSRTTISRRNPPSTWC*GFVV 714
           K K + K   L  +   S LESS +MDV   TT SRR+   TW   FVV
Sbjct: 407 KAKIQDKEVFLRTSSVSSSLESSLRMDVLWPTTTSRRSLLFTWSCVFVV 455


>At4g05320.3 68417.m00812 polyubiquitin (UBQ10) (SEN3)
           senescence-associated protein; identical to GI:870791
          Length = 388

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 298



 Score = 35.5 bits (78), Expect = 0.048
 Identities = 16/18 (88%), Positives = 17/18 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKE 838
           VE SDTI+NVKAKIQDKE
Sbjct: 321 VESSDTIDNVKAKIQDKE 338



 Score = 31.9 bits (69), Expect = 0.59
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = -3

Query: 860 KLKFKTKRESLPINKG*SLLESSWKMDVPSRTTISRRNPPSTWC*GFVV 714
           K K + K   L  +   S LESS +MDV   TT SRR+   TW   FVV
Sbjct: 331 KAKIQDKEVFLRTSSVSSSLESSLRMDVLWPTTTSRRSLLFTWSCVFVV 379


>At4g05320.2 68417.m00811 polyubiquitin (UBQ10) (SEN3)
           senescence-associated protein; identical to GI:870791
          Length = 464

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 298



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 321 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 374



 Score = 35.5 bits (78), Expect = 0.048
 Identities = 16/18 (88%), Positives = 17/18 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKE 838
           VE SDTI+NVKAKIQDKE
Sbjct: 397 VESSDTIDNVKAKIQDKE 414



 Score = 31.9 bits (69), Expect = 0.59
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = -3

Query: 860 KLKFKTKRESLPINKG*SLLESSWKMDVPSRTTISRRNPPSTWC*GFVV 714
           K K + K   L  +   S LESS +MDV   TT SRR+   TW   FVV
Sbjct: 407 KAKIQDKEVFLRTSSVSSSLESSLRMDVLWPTTTSRRSLLFTWSCVFVV 455


>At4g05320.1 68417.m00810 polyubiquitin (UBQ10) (SEN3)
           senescence-associated protein; identical to GI:870791
          Length = 388

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 298



 Score = 35.5 bits (78), Expect = 0.048
 Identities = 16/18 (88%), Positives = 17/18 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKE 838
           VE SDTI+NVKAKIQDKE
Sbjct: 321 VESSDTIDNVKAKIQDKE 338



 Score = 31.9 bits (69), Expect = 0.59
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = -3

Query: 860 KLKFKTKRESLPINKG*SLLESSWKMDVPSRTTISRRNPPSTWC*GFVV 714
           K K + K   L  +   S LESS +MDV   TT SRR+   TW   FVV
Sbjct: 331 KAKIQDKEVFLRTSSVSSSLESSLRMDVLWPTTTSRRSLLFTWSCVFVV 379


>At4g05050.1 68417.m00744 polyubiquitin (UBQ11) identical to
           GI:304117
          Length = 229

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222


>At4g02890.3 68417.m00391 polyubiquitin (UBQ14) identical to
           GI:166795; similar to N. sylvestris hexameric
           polyubiquitin, GenBank accession number M74101
          Length = 305

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 298


>At4g02890.2 68417.m00390 polyubiquitin (UBQ14) identical to
           GI:166795; similar to N. sylvestris hexameric
           polyubiquitin, GenBank accession number M74101
          Length = 229

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222


>At4g02890.1 68417.m00389 polyubiquitin (UBQ14) identical to
           GI:166795; similar to N. sylvestris hexameric
           polyubiquitin, GenBank accession number M74101
          Length = 305

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 298


>At3g52590.1 68416.m05792 ubiquitin extension protein 1 (UBQ1) / 60S
           ribosomal protein L40 (RPL40B) identical to GI:166929,
           GI:166930
          Length = 128

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70


>At2g36170.1 68415.m04439 ubiquitin extension protein 2 (UBQ2) / 60S
           ribosomal protein L40 (RPL40A) identical to GI:166930,
           GI:166931
          Length = 128

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70


>At2g35635.1 68415.m04370 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 154

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score = 75.4 bits (177), Expect = 5e-14
 Identities = 32/54 (59%), Positives = 43/54 (79%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+DTI+ +K ++++KEGIPP QQRLI+AGKQL D +T  DY I+  S LHLV
Sbjct: 93  IEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDYAIEGGSVLHLV 146


>At1g65350.1 68414.m07413 polyubiquitin, putative similar to
           polyubiquitin GI:248337 from [Zea mays]
          Length = 294

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  103 bits (247), Expect = 2e-22
 Identities = 49/54 (90%), Positives = 52/54 (96%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKE IPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 168 VESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 221



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 49/54 (90%), Positives = 52/54 (96%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+D NIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD-NIQKESTLHLV 145



 Score = 68.1 bits (159), Expect = 7e-12
 Identities = 32/37 (86%), Positives = 34/37 (91%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDG 781
           VE S TI+NVKAKIQDKEGIPP+QQRLIFAGKQLE G
Sbjct: 244 VESSGTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEGG 280


>At1g31340.1 68414.m03835 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 156

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score = 78.6 bits (185), Expect = 5e-15
 Identities = 33/54 (61%), Positives = 44/54 (81%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+DTI+ +K ++++KEGIPP QQRLI+AGKQL D +T  DYNI+  S LHLV
Sbjct: 93  IEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDYNIEGGSVLHLV 146


>At1g55060.1 68414.m06289 polyubiquitin (UBQ12) identical to
           polyubiquitin (ubq12) gene sequence GI:304121 from
           [Arabidopsis thaliana]
          Length = 230

 Score =  105 bits (252), Expect = 4e-23
 Identities = 49/54 (90%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+N+KAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNLKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  100 bits (240), Expect = 1e-21
 Identities = 48/54 (88%), Positives = 51/54 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGI P+QQRLIFAGKQ EDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGISPDQQRLIFAGKQHEDGRTLADYNIQKESTLHLV 222



 Score = 97.1 bits (231), Expect = 1e-20
 Identities = 44/54 (81%), Positives = 51/54 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQD EGIPP+Q RLIFAGKQLEDGRTL+DYN+Q++STLHL+
Sbjct: 17  VESSDTIDNVKAKIQDIEGIPPDQHRLIFAGKQLEDGRTLADYNVQEDSTLHLL 70


>At5g37640.1 68418.m04533 polyubiquitin (UBQ9) identical to
           polyubiquitin (ubq9) gene sequence GI:304120 from
           [Arabidopsis thaliana]
          Length = 322

 Score =  105 bits (251), Expect = 5e-23
 Identities = 48/54 (88%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEG+PP+QQRLIFAGKQL+DGRTL+DYNIQKESTLHLV
Sbjct: 95  VESSDTIDNVKAKIQDKEGVPPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLV 148



 Score =  104 bits (250), Expect = 7e-23
 Identities = 49/54 (90%), Positives = 52/54 (96%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDT +NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 171 VESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 224



 Score = 91.5 bits (217), Expect = 7e-19
 Identities = 46/55 (83%), Positives = 50/55 (90%), Gaps = 1/55 (1%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDG-RTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKE I P+QQRLIFAG+QLEDG  TL+DYNIQKESTLHLV
Sbjct: 247 VESSDTIDNVKAKIQDKERIQPDQQRLIFAGEQLEDGYYTLADYNIQKESTLHLV 301



 Score = 83.4 bits (197), Expect = 2e-16
 Identities = 40/53 (75%), Positives = 46/53 (86%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  SDTI NVKAKIQD EGIP +QQRLIF+GK L+DGRTL+DY+IQK+S LHL
Sbjct: 19  VVSSDTINNVKAKIQDIEGIPLDQQRLIFSGKLLDDGRTLADYSIQKDSILHL 71


>At3g09790.1 68416.m01163 polyubiquitin (UBQ8) identical to
           polyubiquitin (ubq8) GI:870793, GB:L05917 [Arabidopsis
           thaliana] (Genetics 139 (2), 921-939 (1995))
          Length = 631

 Score =  100 bits (240), Expect = 1e-21
 Identities = 48/54 (88%), Positives = 51/54 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+ SDTI+NVKAKIQDKEGI P QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 95  VKSSDTIDNVKAKIQDKEGILPRQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 148



 Score = 95.5 bits (227), Expect = 4e-20
 Identities = 46/54 (85%), Positives = 50/54 (92%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SD+I NVKAKIQ+KEGIP +QQRLIFAGKQLEDG TL+DYNIQKESTLHLV
Sbjct: 19  VETSDSIHNVKAKIQNKEGIPLDQQRLIFAGKQLEDGLTLADYNIQKESTLHLV 72



 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 42/56 (75%), Positives = 47/56 (83%), Gaps = 2/56 (3%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPP--NQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE  DTIENVKA +QDKEGI P  N QRLIF GK+L+DG TL+DY+IQKESTLHLV
Sbjct: 335 VESWDTIENVKAMVQDKEGIQPQPNLQRLIFLGKELKDGCTLADYSIQKESTLHLV 390



 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 40/54 (74%), Positives = 45/54 (83%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAK+QDKE IP +  RLIFAGK LE GRTL+ YNIQK STL+LV
Sbjct: 259 VESSDTIDNVKAKLQDKERIPMDLHRLIFAGKPLEGGRTLAHYNIQKGSTLYLV 312



 Score = 80.2 bits (189), Expect = 2e-15
 Identities = 37/50 (74%), Positives = 43/50 (86%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           SDTI++VKAKIQDK G PP+QQ L+F G QL+DGRTL DYNI+ ESTLHL
Sbjct: 412 SDTIKSVKAKIQDKVGSPPDQQILLFRGGQLQDGRTLGDYNIRNESTLHL 461



 Score = 78.6 bits (185), Expect = 5e-15
 Identities = 39/54 (72%), Positives = 44/54 (81%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI NVK KIQ KEGI P+QQ LIF G+QLEDG TL DY+I K+STL+LV
Sbjct: 568 VESSDTIANVKEKIQVKEGIKPDQQMLIFFGQQLEDGVTLGDYDIHKKSTLYLV 621



 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 2/55 (3%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQL--EDGRTLSDYNIQKESTLHL 733
           VE SDTIENVKAKIQD+EG+ P+ QRLIF G++L  ED RTL+DY I+  STL L
Sbjct: 176 VESSDTIENVKAKIQDREGLRPDHQRLIFHGEELFTEDNRTLADYGIRNRSTLCL 230



 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 35/52 (67%), Positives = 40/52 (76%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLH 736
           VE SDTI+NVK KIQ K GIP ++QRLIF G+ L   RTL DYNIQK ST+H
Sbjct: 492 VESSDTIDNVKVKIQHKVGIPLDRQRLIFGGRVLVGSRTLLDYNIQKGSTIH 543


>At1g53930.1 68414.m06139 ubiquitin family protein contains Pfam
           profile: PF00240 ubiquitin family
          Length = 158

 Score = 89.4 bits (212), Expect = 3e-18
 Identities = 41/54 (75%), Positives = 47/54 (87%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE  DTIEN+KAKIQDK+GIP +QQRLIF GKQLEDG TL+DYNIQ +S LHL+
Sbjct: 102 VENCDTIENIKAKIQDKQGIPVDQQRLIFKGKQLEDGLTLADYNIQNDSILHLI 155


>At1g11980.1 68414.m01384 ubiquitin family protein similar to Chain
           A, Structure Of Ubiquitin-Like Protein, Rub1 GI:6729726
           from [Arabidopsis thaliana]
          Length = 78

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 28/54 (51%), Positives = 40/54 (74%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E +DTIE +K +I++KEGIPP  QR+++ GKQL D  T   YN+++ S LHLV
Sbjct: 17  IELTDTIERIKERIEEKEGIPPVHQRIVYTGKQLADDLTAKHYNLERGSVLHLV 70


>At5g42220.1 68418.m05139 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 879

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 23/54 (42%), Positives = 35/54 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  ++T+   K KI  + G+P  QQRLIF G+ L+D   LS+Y+++   TLHL+
Sbjct: 40  VNKNETVLLFKEKIASETGVPVGQQRLIFRGRVLKDDHPLSEYHLENGHTLHLI 93


>At2g17200.1 68415.m01986 ubiquitin family protein weak similarity
           to PLIC-2 (ubiquitin-like type II) [Homo sapiens]
           GI:9937505; contains Pfam profiles PF00240: Ubiquitin
           family, PF00627: UBA/TS-N domain
          Length = 551

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 20/49 (40%), Positives = 32/49 (65%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+E+ K  +     +P NQQRLI+ G+ L+D +TL  Y +Q + T+H+V
Sbjct: 39  TVESFKELVAQSSDVPANQQRLIYKGRILKDDQTLLSYGLQADHTIHMV 87


>At2g17190.1 68415.m01985 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 538

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+E+ K  I     +P NQQRLI+ G+ L+D +TL  Y +Q + T+H+V
Sbjct: 39  TVESFKELIAQNSDVPANQQRLIYKGRILKDDQTLLSYGLQADHTVHMV 87


>At1g53950.1 68414.m06145 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 216

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 22/51 (43%), Positives = 35/51 (68%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           V+ SDTI+ +K+ I D+ G P +QQ L   G +L++  T+SDYNI+ ++ L
Sbjct: 157 VKGSDTIKKLKSMIHDQGGPPVDQQDLNHLGTKLKNNATISDYNIKPDANL 207



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 20/32 (62%), Positives = 25/32 (78%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGK 796
           V+ SDTI  +KAK ++KEGIP  QQRLIF G+
Sbjct: 66  VKGSDTIRELKAKHEEKEGIPVEQQRLIFQGR 97


>At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative similar
           to SP|P39940 Ubiquitin--protein ligase RSP5 (EC 6.3.2.-)
           {Saccharomyces cerevisiae}; contains Pfam profiles
           PF00240: Ubiquitin family, PF00632: HECT-domain
           (ubiquitin-transferase)
          Length = 873

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 21/53 (39%), Positives = 37/53 (69%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           E  DT+E +  +I+ K  IP  +QR+I+ GKQL+   +L+ Y+I+++++L LV
Sbjct: 113 EKYDTVEKLHQRIEWKTKIPALEQRVIYKGKQLQRENSLTYYSIEQDASLQLV 165


>At4g02970.1 68417.m00404 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 270

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 21/53 (39%), Positives = 30/53 (56%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           ++  +T+  +K KI+  +GIP ++Q L   GK LED     DY I  ES L L
Sbjct: 17  IDFGETVLEIKEKIEKSQGIPVSKQILYLDGKALEDDLHKIDYMILFESRLLL 69


>At5g11080.1 68418.m01294 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 352

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQ-RLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE +  + ++K  I    G+ P +Q RL+F G+ L++ + LSDY++++  TL+LV
Sbjct: 27  VERTIPVRDLKQDICYYCGVSPERQPRLLFRGRVLKNDQRLSDYHVEEGHTLYLV 81


>At4g03350.1 68417.m00457 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 263

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           ++  +T+  +K KI+  +GIP ++Q L   GK LED     DY I  ES L
Sbjct: 17  IDFGETVLQIKEKIEKSQGIPVSKQILYLDGKALEDDLHKIDYMILFESLL 67


>At4g03370.1 68417.m00459 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 295

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           DT+   K KI+  + IP ++Q + F GK LED   + +++I +   LHL
Sbjct: 21  DTVLTFKRKIEMTQRIPVSRQTIFFQGKLLEDHLDIFEWDILQNPLLHL 69


>At3g13235.1 68416.m01666 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 414

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 15/54 (27%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+  +T+ENVKA ++ +  +P  QQ+L++ G ++ +   LS   ++ +  L ++
Sbjct: 17  VDSQETVENVKALLEVESNVPIQQQQLLYNGNEMGNSDKLSALGVKDDDLLMMM 70


>At1g79650.3 68414.m09289 DNA repair protein RAD23, putative similar
           to DNA repair by nucleotide excision (NER) RAD23
           protein, isoform II GI:1914685 from [Daucus carota];
           contains Pfam profiles PF00240: Ubiquitin family,
           PF00627: UBA/TS-N domain
          Length = 351

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 3/54 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG---IPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           V PSDTI  VK  I+D +G    P  QQ LI  GK L+D  +L +  + +E  L
Sbjct: 17  VLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLVENKVTEEGFL 70


>At1g79650.2 68414.m09288 DNA repair protein RAD23, putative similar
           to DNA repair by nucleotide excision (NER) RAD23
           protein, isoform II GI:1914685 from [Daucus carota];
           contains Pfam profiles PF00240: Ubiquitin family,
           PF00627: UBA/TS-N domain
          Length = 365

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 3/54 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG---IPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           V PSDTI  VK  I+D +G    P  QQ LI  GK L+D  +L +  + +E  L
Sbjct: 17  VLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLVENKVTEEGFL 70


>At1g79650.1 68414.m09287 DNA repair protein RAD23, putative similar
           to DNA repair by nucleotide excision (NER) RAD23
           protein, isoform II GI:1914685 from [Daucus carota];
           contains Pfam profiles PF00240: Ubiquitin family,
           PF00627: UBA/TS-N domain
          Length = 371

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 3/54 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG---IPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           V PSDTI  VK  I+D +G    P  QQ LI  GK L+D  +L +  + +E  L
Sbjct: 17  VLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLVENKVTEEGFL 70


>At1g16190.1 68414.m01939 DNA repair protein RAD23, putative similar
           to DNA repair by nucleotide excision (NER) RAD23
           protein, isoform II GI:1914685 from [Daucus carota]
          Length = 368

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 3/54 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQD---KEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           V P+DTI  VK  I+D   K+  P  QQ LI  GK L+D  TL +  + +E  L
Sbjct: 17  VLPTDTIMAVKKNIEDSQSKDNYPCGQQLLIHNGKVLKDETTLVENKVTEEGFL 70


>At2g46500.2 68415.m05791 phosphatidylinositol 3- and 4-kinase
           family protein / ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 566

 Score = 36.7 bits (81), Expect = 0.021
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG--IPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE    I  VK +I  K G  + P++Q +++ G++LED   ++D     +S LHL+
Sbjct: 127 VERGRNIGYVKKQISKKRGDFVDPDEQEILYEGEKLEDQSLINDICRNDDSVLHLL 182


>At2g46500.1 68415.m05790 phosphatidylinositol 3- and 4-kinase
           family protein / ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 566

 Score = 36.7 bits (81), Expect = 0.021
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG--IPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE    I  VK +I  K G  + P++Q +++ G++LED   ++D     +S LHL+
Sbjct: 127 VERGRNIGYVKKQISKKRGDFVDPDEQEILYEGEKLEDQSLINDICRNDDSVLHLL 182


>At3g19040.1 68416.m02418 ubiquitin family protein / DNA-binding
           bromodomain-containing protein low similarity to
           SP|P51123 Transcription initiation factor TFIID 230 kDa
           subunit {Drosophila melanogaster}; contains Pfam
           profiles: PF00439 bromodomain, PF00240: Ubiquitin family
          Length = 1700

 Score = 35.9 bits (79), Expect = 0.036
 Identities = 15/51 (29%), Positives = 32/51 (62%), Gaps = 1/51 (1%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQ-RLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +++ ++KAK   K      +  ++ + GK+LED ++L++ N+Q  S +HL+
Sbjct: 520 ESVSSLKAKASRKLDFKETEAVKMFYMGKELEDEKSLAEQNVQPNSLVHLL 570


>At4g01000.1 68417.m00135 ubiquitin family protein low similarity to
           SP|P13117 Ubiquitin. {Neurospora crassa}; contains Pfam
           profile PF00240: Ubiquitin family
          Length = 415

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = -2

Query: 870 ENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           E +K +I ++  IP + QRLI  G Q+ DG  +S    Q ++T++LV
Sbjct: 33  EQIKQRIFEQTKIPTHLQRLISGGYQISDGSAIS----QPDATVNLV 75


>At5g14360.1 68418.m01678 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 163

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLED 784
           +E + T   +K  +    G+ P QQRL+F GK+ ED
Sbjct: 85  IEATSTFGELKMVLSLLTGLEPKQQRLVFKGKERED 120


>At4g05230.1 68417.m00789 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 206

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           DT+  +K KI+  + IP ++Q L+F G  L+D   +    I   S + L
Sbjct: 21  DTVLEIKQKIEKYQRIPVSKQTLLFQGNVLQDHLDIEQCVILNHSRIQL 69


>At1g32750.1 68414.m04038 HAC13 protein (HAC13) identical to HAC13
           [Arabidopsis thaliana] gi|21105767|gb|AAM34782; contains
           Pfam domains, PF00439: Bromodomain and PF00240:
           Ubiquitin family
          Length = 1919

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 13/51 (25%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQ-RLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +++ +++AK   K      +  ++ + GK+L+D ++L+  N+Q  S +HL+
Sbjct: 681 ESVSSLRAKASRKLDFKETEAVKMFYKGKELDDEKSLAAQNVQPNSLVHLI 731


>At4g03360.1 68417.m00458 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 284

 Score = 31.5 bits (68), Expect = 0.78
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           DT+  +K KI+  +G P ++Q LIF  K L+D   +    I+  S + L
Sbjct: 22  DTVLMIKRKIEMTQGTPVSKQILIFKRKVLQDHLNMFGCQIRHNSRILL 70


>At4g02950.1 68417.m00402 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 318

 Score = 31.5 bits (68), Expect = 0.78
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           DT+  +K KI+  +G P ++Q LIF  K L+D   +    I+  S + L
Sbjct: 56  DTVLMIKRKIEMTQGTPVSKQILIFKRKVLQDHLNMFGCQIRHNSRILL 104


>At4g05250.1 68417.m00793 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 318

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLED 784
           DT+  +K KI+  + IP ++Q LIF G  L+D
Sbjct: 21  DTMLEIKEKIEKYQCIPVSKQTLIFQGVVLQD 52


>At5g24240.1 68418.m02852 phosphatidylinositol 3- and 4-kinase
           family protein / ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain, Pfam profile
           PF00454:  Phosphatidylinositol 3- and 4-kinase
          Length = 574

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 3/57 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKE---GIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE S  +  VK +I  KE   GIP + + L   G++L+D R ++D     ++ +HL+
Sbjct: 125 VERSRNVGYVKQQIASKEKELGIPRDHE-LTLDGEELDDQRLITDLCQNGDNVIHLL 180


>At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal,
           putative / glycolate oxidase, putative / short chain
           alpha-hydroxy acid oxidase, putative similar to Chain A,
           Glycolate Oxidase (E.C.1.1.3.15) Mutant With Tyr 24
           Replaced By Phe (Y24f) gi|999542
          Length = 363

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 2/42 (4%)
 Frame = +1

Query: 730 HQVEGGF--LLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVL 849
           H V+G    LLD  VR GT +F+ L+   Q +LIGR  ++ L
Sbjct: 272 HAVKGRIPVLLDGGVRRGTDVFKALALGAQAVLIGRPIVYGL 313


>At1g22050.1 68414.m02758 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 119

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 7/46 (15%)
 Frame = -2

Query: 882 SDTIENVKAKI-----QDKEGIPP--NQQRLIFAGKQLEDGRTLSD 766
           S T+ ++K K+     +DKE  P   N  +LI AGK LE+ RTL++
Sbjct: 28  SMTVSSLKEKLISQWPKDKENTPKTVNDMKLINAGKILENNRTLAE 73


>At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp
           domain-containing protein / ubiquitin family protein
           similar to SP|Q15459 Splicing factor 3 subunit 1
           (Spliceosome associated protein 114) {Homo sapiens};
           contains Pfam profiles PF00240: Ubiquitin family,
           PF01805: Surp module
          Length = 785

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNI 757
           S+ + ++K KI  +  IP N+Q+L      L+D  +L+ YN+
Sbjct: 726 SENVGSLKEKIAGEIQIPANKQKLSGKAGFLKDNMSLAHYNV 767


>At5g40630.1 68418.m04932 ubiquitin family protein contains
           INTERPRO:IPR000626 ubiquitin domain
          Length = 165

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLED 784
           ++ + T   +K  I    GI   +QRL+F GK+ ED
Sbjct: 95  IDANSTFGELKMMIAIVSGIEAKEQRLLFRGKERED 130


>At2g12550.1 68415.m01357 ubiquitin-associated (UBA)/TS-N
           domain-containing protein low similarity to NUB1
           (NEDD8-interacting protein) [Homo sapiens] GI:13383476;
           contains Pfam profile PF00627: UBA/TS-N domain
          Length = 562

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 4/50 (8%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDG----RTLSDYNIQKESTL 739
           T+  ++ ++  + G+ P   +LIFAGK L+D      TLS   I++ S +
Sbjct: 22  TLNMLRDEVAKRSGLDPESIKLIFAGKILKDDGDATLTLSQLGIKENSKI 71


>At3g14150.1 68416.m01789 (S)-2-hydroxy-acid oxidase, peroxisomal,
           putative / glycolate oxidase, putative / short chain
           alpha-hydroxy acid oxidase, putative similar to
           (S)-2-hydroxy-acid oxidase, peroxisomal (Glycolate
           oxidase, GOX) (Short chain alpha-hydroxy acid oxidase)
           [Spinacia oleracea] SWISS-PROT:P05414
          Length = 363

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +1

Query: 751 LLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVL 849
           LLD  VR GT +F+ L+   Q +LIGR  ++ L
Sbjct: 281 LLDGGVRRGTDVFKALALGAQAVLIGRPIIYGL 313


>At1g47680.1 68414.m05297 hypothetical protein
          Length = 104

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEG-IPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           E  D +E++  K  ++ G +     +L  +G+Q+   R L DY +Q E+T  L
Sbjct: 31  EEDDGMEDITKKYHNEVGEVVQGVPQLRRSGRQISQSRYLEDYVMQSETTYGL 83


>At5g12280.1 68418.m01444 hypothetical protein
          Length = 419

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNI 757
           S+ + ++K KI  +   P N+Q+L      L+D  +L+ YN+
Sbjct: 367 SENVASLKEKISGEIQFPTNKQKLRGKAGFLKDNTSLAHYNV 408


>At3g11760.1 68416.m01443 expressed protein 
          Length = 702

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 21/65 (32%), Positives = 30/65 (46%)
 Frame = -1

Query: 373 YLLKGNFFDEKTIVHRTCAASVLMNMEIGLPTVKEVSILSRAPTLLSQLFKFLCIYLLIR 194
           Y+LK   FD KT++H+     +L   E G  +  E  ILSR      +  K     + IR
Sbjct: 616 YVLK---FDHKTVIHK-----ILHTEEAGSESEPESEILSRGKESCKEYIKNFLAAIPIR 667

Query: 193 FTQQD 179
             Q+D
Sbjct: 668 ELQED 672


>At1g19980.1 68414.m02503 cytomatrix protein-related contains weak
           similarity to CAST1 [Rattus norvegicus]
           gi|22138113|gb|AAL07517
          Length = 342

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%)
 Frame = -1

Query: 469 KSPLAC--KERSRLLCMMDFK*NLDTVSELTRWFYLLKGN 356
           KS L C  KE+ R LC +  + +LD + +   WF  L  N
Sbjct: 86  KSNLLCGLKEKDRSLCNLKLEHSLDELKDFKAWFDFLTLN 125


>At4g18360.1 68417.m02723 (S)-2-hydroxy-acid oxidase, peroxisomal,
           putative / glycolate oxidase, putative / short chain
           alpha-hydroxy acid oxidase, putative similar to
           (S)-2-hydroxy-acid oxidase, peroxisomal (Glycolate
           oxidase, GOX) (Short chain alpha-hydroxy acid oxidase)
           [Spinacia oleracea] SWISS-PROT:P05414
          Length = 368

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +1

Query: 754 LDIVVREGTSIFQLLSSKDQPLLIGRDSLFVL 849
           LD  VR GT +F+ L+     + +GR SLF L
Sbjct: 284 LDGGVRRGTDVFKALALGASGVFVGRPSLFSL 315


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,754,499
Number of Sequences: 28952
Number of extensions: 356564
Number of successful extensions: 994
Number of sequences better than 10.0: 61
Number of HSP's better than 10.0 without gapping: 904
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 990
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2090971320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).