SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0023
         (852 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g53920.1 68418.m06709 ribosomal protein L11 methyltransferase...    31   1.3  
At5g51530.1 68418.m06390 ubiquitin carboxyl-terminal hydrolase-r...    30   2.2  
At1g24540.1 68414.m03089 cytochrome P450, putative similar to GB...    28   9.1  

>At5g53920.1 68418.m06709 ribosomal protein L11
           methyltransferase-related similar to ribosomal protein
           L11 methyltransferase; PrmA [Escherichia coli] GI:455655
          Length = 371

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 16/61 (26%), Positives = 28/61 (45%)
 Frame = +3

Query: 201 LTAHLVLSGYPKPIDIYNVNAPPTLRYKF*DLSMVRKNRLSTNCVKNYICRVPYLFVRRR 380
           L+ H++     +P+  +  + PP+    F  LS    +  S++C  +     PYL VR  
Sbjct: 15  LSRHILRDSRVRPLCFFTSSTPPSSFSIFASLSTSSSSSSSSSCFTDESFAAPYLSVRIH 74

Query: 381 C 383
           C
Sbjct: 75  C 75


>At5g51530.1 68418.m06390 ubiquitin carboxyl-terminal
           hydrolase-related contains Pfam profiles PF00443:
           Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein
           of unknown function (DUF629), PF04781: Protein of
           unknown function (DUF627)
          Length = 1149

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 20/83 (24%), Positives = 39/83 (46%)
 Frame = +3

Query: 498 MRRSKHPIKHFLKN*SCLNIEEERLFGLNNIFVILQESHLKLNISKKYRNKIKLLRLFDK 677
           ++ + HP   FL +  C+N+  +R   L +   +    HLK  ++ K       + L D 
Sbjct: 602 LQGASHPTFDFLDSEDCMNLIRQRK-SLGDDIALKSIHHLKSVVTHKVLLIDSKILLIDN 660

Query: 678 SKLN*SSIKNIGLLMLITNKTYL 746
           S++  + + N+  L    N+TY+
Sbjct: 661 SRI--TLLTNLTRLSAFDNRTYI 681


>At1g24540.1 68414.m03089 cytochrome P450, putative similar to
           GB:AAB87111, similar to ESTs dbj|D41610, gb|T20562 and
           emb|Z26058
          Length = 522

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +2

Query: 548 FKYRGGKAIWFEQHFCYFTGEPFKVEHFEKIS*QNKTSSAI*QE 679
           F YRG   IWF   +   T +P  VEH  K + +N    A  +E
Sbjct: 77  FHYRG---IWFGGAYGIMTADPANVEHILKTNFKNYPKGAFYRE 117


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,980,587
Number of Sequences: 28952
Number of extensions: 382185
Number of successful extensions: 772
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 759
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 772
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1980143200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).