SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0022
         (906 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g02630.1 68418.m00199 expressed protein                             29   3.2  
At5g22600.1 68418.m02640 expressed protein ; expression supporte...    29   4.2  

>At5g02630.1 68418.m00199 expressed protein
          Length = 428

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = -2

Query: 662 LIHVPIKLQHNSALCVTESHYV 597
           L HV ++LQ N + CV +SHY+
Sbjct: 79  LPHVLLELQQNFSFCVLDSHYI 100


>At5g22600.1 68418.m02640 expressed protein ; expression supported
           by MPSS
          Length = 418

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 4/57 (7%)
 Frame = -2

Query: 647 IKLQHNSALCVTESHY---VALCSVIGKLPLLEVTTVMTIVDNLNLL*I-ARDMRSF 489
           + L H   LC+  + Y    ++ S+I   P+LE  T++ I DN+ +L + ++ + SF
Sbjct: 112 VSLPHLKTLCLERNIYPNEASVESLISSCPVLEDLTILRINDNVKVLRVHSQSLTSF 168


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,794,064
Number of Sequences: 28952
Number of extensions: 220963
Number of successful extensions: 343
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 339
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 343
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2139598560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).