SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0021
         (602 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family...    32   0.25 
At3g09880.1 68416.m01178 serine/threonine protein phosphatase 2A...    28   4.1  
At5g67570.1 68418.m08520 pentatricopeptide (PPR) repeat-containi...    27   9.6  
At5g61090.1 68418.m07665 proline-rich family protein contains pr...    27   9.6  
At2g26080.1 68415.m03131 glycine dehydrogenase [decarboxylating]...    27   9.6  

>At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family
           protein contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 175

 Score = 32.3 bits (70), Expect = 0.25
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +2

Query: 206 EAEISGGTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPSIMAP 337
           E   + G   +++G+  + + + RL+R +P   PP PSP    P
Sbjct: 32  ECNCNSGACNSLVGATYYPSCKPRLQRYSPYGNPPPPSPQYSPP 75


>At3g09880.1 68416.m01178 serine/threonine protein phosphatase 2A
           (PP2A) regulatory subunit B' (B'beta) identical to B'
           regulatory subunit of PP2A [Arabidopsis thaliana]
           GI:2160692; similar to SWISS-PROT:Q28653
           serine/threonine protein phosphatase 2A, 56 kDa
           regulatory subunit, delta isoform (PP2A, B subunit, B'
           delta isoform, PP2A, B subunit, B56 delta isoform, PP2A,
           B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta
           isoform, PP2A, B subunit, B'-gamma) [Oryctolagus
           cuniculus]; contains Pfam domain, PF01603: Protein
           phosphatase 2A regulatory B subunit (B56 family)
          Length = 499

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = -3

Query: 342 SYGAMIEGLGSG-GACIGATRSRRACTASHVPDPITARPVPPDISA 208
           SYG  +    SG G+ +  + + R    +  P P+TA P PP + +
Sbjct: 23  SYGIGLPDNRSGPGSNVVVSHASRGALVNSSPSPVTATPPPPPLGS 68


>At5g67570.1 68418.m08520 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 611

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 2/41 (4%)
 Frame = +2

Query: 155 MEESSKFQQMQDEMSRFEAEISGGTGRAV--IGSGTWDAVQ 271
           MEE ++FQ ++ E  +F   ISG  G  V  +    W+ ++
Sbjct: 76  MEEEARFQTLRREYKQFTRSISGKRGGDVGLMVGNPWEGIE 116


>At5g61090.1 68418.m07665 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965;
           contains similarity to vegetative cell wall protein gp1
           [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420;
           common family members: At4g18570, At3g25690, At4g04980
           [Arabidopsis thaliana]
          Length = 344

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 11/23 (47%), Positives = 13/23 (56%)
 Frame = -3

Query: 291 ATRSRRACTASHVPDPITARPVP 223
           A RS  AC    +P P+ ARP P
Sbjct: 103 APRSVPACPIPEIPRPVPARPTP 125


>At2g26080.1 68415.m03131 glycine dehydrogenase [decarboxylating],
           putative / glycine decarboxylase, putative / glycine
           cleavage system P-protein, putative strong similarity to
           SP|P26969 Glycine dehydrogenase [decarboxylating],
           mitochondrial precursor (EC 1.4.4.2) {Pisum sativum};
           contains Pfam profile PF02347: Glycine cleavage system
           P-protein
          Length = 1044

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +3

Query: 108 CVNLLEFFKVKVGASSWKNPQSFNRCKMRCPGLKLKYQEALDVQ*SDLAHGMPC 269
           C N+L+  K     +S  +PQ+ + CK R  G  LK    +D++  D + G  C
Sbjct: 234 CNNILKGKKKTFVIASNCHPQTIDVCKTRADGFDLKV-VTVDIKDVDYSSGDVC 286


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,701,958
Number of Sequences: 28952
Number of extensions: 227564
Number of successful extensions: 673
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 648
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 673
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1197101088
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).