SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0020
         (788 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496...   459   e-130
At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A...   458   e-129
At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A...   458   e-129
At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A...   456   e-129
At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497...   455   e-128
At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S...   454   e-128
At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A...   446   e-126
At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A...   446   e-126
At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A...   446   e-126
At2g42100.1 68415.m05205 actin, putative very strong similarity ...   423   e-119
At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac...   359   2e-99
At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara...   311   3e-85
At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i...   252   2e-67
At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica...   173   8e-44
At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id...   161   4e-40
At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i...   126   1e-29
At3g12380.1 68416.m01543 actin/actin-like family protein similar...   111   7e-25
At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica...   104   8e-23
At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identica...   104   8e-23
At5g56180.2 68418.m07009 actin-related protein, putative (ARP8) ...    72   5e-13
At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) ...    72   5e-13
At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel...    37   0.018
At5g43500.2 68418.m05318 expressed protein                             35   0.054
At5g43500.1 68418.m05319 expressed protein                             35   0.054
At1g20130.1 68414.m02518 family II extracellular lipase, putativ...    35   0.054
At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica...    35   0.071
At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica...    35   0.071
At1g51090.1 68414.m05744 heavy-metal-associated domain-containin...    35   0.071
At5g01040.1 68418.m00007 laccase family protein / diphenol oxida...    34   0.12 
At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex...    34   0.12 
At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t...    34   0.12 
At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex...    34   0.12 
At3g05690.1 68416.m00636 CCAAT-binding transcription factor (CBF...    34   0.12 
At3g24550.1 68416.m03083 protein kinase family protein contains ...    33   0.16 
At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t...    33   0.29 
At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex...    33   0.29 
At1g10620.1 68414.m01204 protein kinase family protein contains ...    33   0.29 
At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c...    33   0.29 
At4g27850.1 68417.m03999 proline-rich family protein contains pr...    32   0.38 
At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex...    32   0.38 
At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-relate...    32   0.38 
At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly id...    32   0.50 
At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly id...    32   0.50 
At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id...    32   0.50 
At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1...    32   0.50 
At5g38560.1 68418.m04662 protein kinase family protein contains ...    31   0.66 
At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex...    31   0.66 
At3g50580.1 68416.m05532 proline-rich family protein contains pr...    31   0.66 
At1g32190.1 68414.m03959 expressed protein                             31   0.66 
At5g17420.1 68418.m02044 cellulose synthase, catalytic subunit (...    31   0.87 
At4g25620.1 68417.m03690 hydroxyproline-rich glycoprotein family...    31   0.87 
At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t...    31   0.87 
At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t...    31   0.87 
At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid t...    31   1.2  
At3g28790.1 68416.m03593 expressed protein                             31   1.2  
At2g40070.1 68415.m04923 expressed protein                             31   1.2  
At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica...    30   2.0  
At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex...    30   2.0  
At5g14920.1 68418.m01750 gibberellin-regulated family protein si...    29   2.7  
At5g11990.1 68418.m01402 proline-rich family protein contains pr...    29   2.7  
At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t...    29   2.7  
At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit...    29   2.7  
At1g49750.1 68414.m05579 leucine-rich repeat family protein cont...    29   2.7  
At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex...    29   2.7  
At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr...    29   2.7  
At1g16690.2 68414.m01999 transcription factor-related similar to...    29   3.5  
At1g16690.1 68414.m01998 transcription factor-related similar to...    29   3.5  
At5g56330.1 68418.m07031 carbonic anhydrase family protein conta...    29   4.6  
At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identica...    29   4.6  
At1g61080.1 68414.m06877 proline-rich family protein                   29   4.6  
At5g61090.1 68418.m07665 proline-rich family protein contains pr...    28   6.1  
At4g01985.1 68417.m00265 expressed protein                             28   6.1  
At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy...    28   6.1  
At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex...    28   6.1  
At1g02405.1 68414.m00187 proline-rich family protein contains pr...    28   6.1  
At5g29020.1 68418.m03592 hypothetical protein                          28   8.1  
At5g23150.1 68418.m02707 PWWP domain-containing protein identica...    28   8.1  
At4g34440.1 68417.m04894 protein kinase family protein contains ...    28   8.1  
At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t...    28   8.1  
At4g01900.1 68417.m00250 P II nitrogen sensing protein (GLB I) i...    28   8.1  
At3g51290.1 68416.m05614 proline-rich family protein                   28   8.1  
At3g19480.1 68416.m02469 D-3-phosphoglycerate dehydrogenase, put...    28   8.1  
At2g23990.2 68415.m02866 plastocyanin-like domain-containing pro...    28   8.1  
At2g23990.1 68415.m02865 plastocyanin-like domain-containing pro...    28   8.1  
At2g22510.1 68415.m02670 hydroxyproline-rich glycoprotein family...    28   8.1  
At2g22330.1 68415.m02649 cytochrome P450, putative similar to cy...    28   8.1  
At1g54970.1 68414.m06278 proline-rich family protein similar to ...    28   8.1  
At1g02890.1 68414.m00256 AAA-type ATPase family protein contains...    28   8.1  

>At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496
           Actin 11 {Arabidopsis thaliana}
          Length = 377

 Score =  459 bits (1132), Expect = e-130
 Identities = 215/234 (91%), Positives = 226/234 (96%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTDYLMKILTERGYSFTT+AEREIVRD+KEKL Y+ALD+EQEM TA +SSS+
Sbjct: 185 RDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANTSSSV 238


>At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493
           Actin 3 {Arabidopsis thaliana}; supported by full-length
           cDNA: Ceres: 19581.
          Length = 377

 Score =  458 bits (1128), Expect = e-129
 Identities = 214/234 (91%), Positives = 224/234 (95%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTD LMKILTERGYSFTTTAEREIVRDIKEKLCY+ALD+EQE+ TA +SSS+
Sbjct: 185 RDLTDALMKILTERGYSFTTTAEREIVRDIKEKLCYIALDYEQELETAKTSSSV 238


>At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671
           Actin 1 (Actin 3) {Arabidopsis thaliana}
          Length = 377

 Score =  458 bits (1128), Expect = e-129
 Identities = 214/234 (91%), Positives = 224/234 (95%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTD LMKILTERGYSFTTTAEREIVRDIKEKLCY+ALD+EQE+ TA +SSS+
Sbjct: 185 RDLTDALMKILTERGYSFTTTAEREIVRDIKEKLCYIALDYEQELETAKTSSSV 238


>At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494
           Actin 4 {Arabidopsis thaliana}
          Length = 377

 Score =  456 bits (1125), Expect = e-129
 Identities = 214/234 (91%), Positives = 225/234 (96%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTD+LMKILTERGYSFTTTAEREIVRD+KEKL Y+ALDFEQE+ T+ +SSS+
Sbjct: 185 RDLTDHLMKILTERGYSFTTTAEREIVRDMKEKLSYIALDFEQELETSKTSSSV 238


>At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497
           Actin 12 {Arabidopsis thaliana}
          Length = 377

 Score =  455 bits (1122), Expect = e-128
 Identities = 213/234 (91%), Positives = 225/234 (96%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTD+LMKILTERGYSFTTTAEREIVRD+KEKL Y+ALD+EQE+ T+ +SSS+
Sbjct: 185 RDLTDHLMKILTERGYSFTTTAEREIVRDMKEKLSYIALDYEQELETSKTSSSV 238


>At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to
           SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana}
          Length = 377

 Score =  454 bits (1120), Expect = e-128
 Identities = 215/234 (91%), Positives = 223/234 (95%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTD LMKILTERGY FTTTAEREIVRDIKEKL YVALD+EQE+ TA SSSS+
Sbjct: 185 RDLTDSLMKILTERGYMFTTTAEREIVRDIKEKLAYVALDYEQELETAKSSSSV 238


>At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 377

 Score =  446 bits (1100), Expect = e-126
 Identities = 205/234 (87%), Positives = 224/234 (95%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG++LPHAILRLDLAG
Sbjct: 125 MFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTDYLMKILTERGY FTTTAEREIVRDIKEKL +VA+D+EQEM T+ +SSS+
Sbjct: 185 RDLTDYLMKILTERGYMFTTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSI 238


>At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 371

 Score =  446 bits (1100), Expect = e-126
 Identities = 205/234 (87%), Positives = 224/234 (95%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG++LPHAILRLDLAG
Sbjct: 125 MFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTDYLMKILTERGY FTTTAEREIVRDIKEKL +VA+D+EQEM T+ +SSS+
Sbjct: 185 RDLTDYLMKILTERGYMFTTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSI 238


>At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293
           Actin 8 {Arabidopsis thaliana}; nearly identical to
           SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and
           to At3g18780
          Length = 377

 Score =  446 bits (1100), Expect = e-126
 Identities = 205/234 (87%), Positives = 224/234 (95%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG++LPHAILRLDLAG
Sbjct: 125 MFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTDYLMKILTERGY FTTTAEREIVRDIKEKL +VA+D+EQEM T+ +SSS+
Sbjct: 185 RDLTDYLMKILTERGYMFTTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSI 238


>At2g42100.1 68415.m05205 actin, putative very strong similarity to
           SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493
           Actin 3 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 378

 Score =  423 bits (1041), Expect = e-119
 Identities = 189/234 (80%), Positives = 219/234 (93%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +E  A+V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH+GVMVGM +KD++VGDEAQ++R
Sbjct: 6   DESVAIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHRGVMVGMDEKDTFVGDEAQARR 65

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GIL+LKYPIEHG+V+NWDDMEKIWHHTFYNELR+ PEEHP+LLTEAPLNPK NREKMTQI
Sbjct: 66  GILSLKYPIEHGVVSNWDDMEKIWHHTFYNELRLEPEEHPILLTEAPLNPKVNREKMTQI 125

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFE+F  P+MY+ IQAVLSLY+SGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 126 MFESFAFPSMYIGIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 185

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLT+YL KI+ ERGY++TT+AEREIVRDIKEKLCY+A+D+EQEM  A +SS++
Sbjct: 186 RDLTEYLTKIMMERGYTYTTSAEREIVRDIKEKLCYIAVDYEQEMEKATTSSAI 239


>At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin
           11 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 366

 Score =  359 bits (882), Expect = 2e-99
 Identities = 164/220 (74%), Positives = 191/220 (86%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V D G GM +AGFAGD+AP+ VFP +VGRPR      G+   +SYVG+E  + R ILTL
Sbjct: 4   IVCDKGHGMVQAGFAGDEAPKVVFPCVVGRPRD-----GLNPNESYVGEEGHANRDILTL 58

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           K P+EHGIV NWDDMEKIWH+TFYNELRV PEEHPVLLTEAP NPKANREKMTQIMFE+F
Sbjct: 59  KDPMEHGIVNNWDDMEKIWHYTFYNELRVDPEEHPVLLTEAPYNPKANREKMTQIMFESF 118

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
           + PAMYV++Q+VL LY+SGRTTG+VLD G+ VSHTVP+YEGYALPH ILRLDL GRDLTD
Sbjct: 119 DVPAMYVSMQSVLYLYSSGRTTGVVLDLGERVSHTVPVYEGYALPHGILRLDLGGRDLTD 178

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           YL++I+TERGY++TT+AEREIVRDIKEKLCYVALD+EQEM
Sbjct: 179 YLIEIMTERGYTYTTSAEREIVRDIKEKLCYVALDYEQEM 218


>At2g42170.1 68415.m05219 actin, putative similar to actin 2
           [Arabidopsis thaliana] gi|9293903|dbj|BAB01806
          Length = 329

 Score =  311 bits (764), Expect = 3e-85
 Identities = 144/193 (74%), Positives = 170/193 (88%)
 Frame = +1

Query: 208 MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 387
           MVGM + D +VGD+A+++ GILTL YP+EHG+V+NWDDMEKIW+HTFY+ELRVAPEEHPV
Sbjct: 1   MVGMNENDLFVGDDAEARSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPV 60

Query: 388 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTV 567
           LLTEAPLNPKA+REKMTQIMFETF  P+MY+ +QA LSL+ASGRTTG VLDSGDGVS+ V
Sbjct: 61  LLTEAPLNPKADREKMTQIMFETFAVPSMYIGMQAALSLHASGRTTGTVLDSGDGVSYIV 120

Query: 568 PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF 747
           PIYEG ALPHAILRLDLAGR LT+YLMKI+ ERGY   T+AERE+VRDIKE+  Y+ALD+
Sbjct: 121 PIYEGSALPHAILRLDLAGRHLTNYLMKIMMERGY---TSAEREVVRDIKEQFGYIALDY 177

Query: 748 EQEMATAASSSSL 786
           EQEM  A  SS++
Sbjct: 178 EQEMEKATKSSAI 190


>At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly
           identical to actin-related protein 2 (ARP2) [Arabidopsis
           thaliana] GI:3818624; contains Pfam profile PF00022:
           Actin
          Length = 389

 Score =  252 bits (618), Expect = 2e-67
 Identities = 110/221 (49%), Positives = 157/221 (71%), Gaps = 2/221 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  ++    KD  VG+     R  L
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLMEQQVKDIVVGETCSELRHQL 66

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
            + YP+ +GIV NWDDME +W H FYNEL++ P +  +LLT+ PLNP  NREKM + MFE
Sbjct: 67  DINYPVHNGIVQNWDDMEHVWDHAFYNELKINPSDCKILLTDPPLNPSKNREKMIETMFE 126

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            +N   +++ IQAVL+LYA G  TG+V+DSGDGV+H VP+ +GY+ PH   R+++AGR +
Sbjct: 127 KYNFAGVFIQIQAVLTLYAQGLLTGLVIDSGDGVTHVVPVVDGYSFPHLTKRMNVAGRHI 186

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
           T YL+ +L+ RGY+   TA+ E VR+IKEKLCY++ D+++E
Sbjct: 187 TAYLVDLLSRRGYAMNKTADFETVREIKEKLCYISYDYKRE 227


>At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical
           to actin-related protein 3 (ARP3) [Arabidopsis thaliana]
           GI:21427461; contains Pfam profile PF00022: Actin
          Length = 427

 Score =  173 bits (422), Expect = 8e-44
 Identities = 96/246 (39%), Positives = 140/246 (56%), Gaps = 26/246 (10%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-----------------RPRHQ-GVMVGMG 222
           A+V+DNG+G  K GFAG+  P  + P++V                  + +H  GV   + 
Sbjct: 8   AIVIDNGTGYTKMGFAGNVEPCFILPTVVAVNESFLNQSKSSSKATWQTQHNAGVAADL- 66

Query: 223 QKDSYVGDEAQSK-RGILT--LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 393
             D Y+GDEA +K R   T  L YPIEHG V +WD ME+ W    +N LR  PE+H  LL
Sbjct: 67  --DFYIGDEALAKSRSSSTHNLHYPIEHGQVEDWDAMERYWQQCIFNYLRCDPEDHYFLL 124

Query: 394 TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT-----TGIVLDSGDGVS 558
           TE+PL P  +RE   +I+FETFN P +Y+A+ +VL+L A   T     TG+V+D GDG +
Sbjct: 125 TESPLTPPESREYTGEILFETFNVPGLYIAVNSVLALAAGYTTSKCEMTGVVVDVGDGAT 184

Query: 559 HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVA 738
           H VP+ EGY +   I  + +AG+D+T ++ +++ ERG +       ++ R +KE  CY  
Sbjct: 185 HVVPVAEGYVIGSCIKSIPIAGKDVTLFIQQLMRERGENIPPEDSFDVARKVKEMYCYTC 244

Query: 739 LDFEQE 756
            D  +E
Sbjct: 245 SDIVKE 250


>At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary
           identical to actin-related protein 4 (ARP4) [Arabidopsis
           thaliana] GI:21427463; contains Pfam profile PF00022:
           Actin; supporting cDNA gi|21427462|gb|AF507912.1|
          Length = 441

 Score =  161 bits (392), Expect = 4e-40
 Identities = 87/217 (40%), Positives = 128/217 (58%), Gaps = 22/217 (10%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM--------VGMGQKDS-- 234
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G       M             +DS  
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSEDSKT 64

Query: 235 -----------YVGDEAQS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE 378
                      YVG +A S +R  + +  PI+ GIV++WD ++ IW H F + L + P E
Sbjct: 65  ESEKEKSKRKLYVGSQAMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTE 124

Query: 379 HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVS 558
           HP+LL E PLN +  REK  ++MFE +  PA+++A   VL+ +A+GR T +V+D G G +
Sbjct: 125 HPMLLAEPPLNTQQQREKAAELMFEKYKVPALFMAKNPVLTSFATGRATSLVVDCGGGST 184

Query: 559 HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 669
              P+++GY L  A++   L G  LTD L+K L  +G
Sbjct: 185 TISPVHDGYVLQKAVVSSPLGGEFLTDCLLKSLESKG 221


>At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly
           identical to actin-related protein 6 (ARP6) [Arabidopsis
           thaliana] GI:21427467; contains Pfam profile PF00022:
           Actin
          Length = 421

 Score =  126 bits (305), Expect = 1e-29
 Identities = 75/239 (31%), Positives = 127/239 (53%), Gaps = 10/239 (4%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNG G+ KAG  G+  P  V P+ + +P      +      + + DE         +
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKPLSSKKFIHPSPLTT-LSDEIDLTSA--AV 61

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           + PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE F
Sbjct: 62  RRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFEDF 121

Query: 460 NTPAMYVA-IQAVLSLYASGR---------TTGIVLDSGDGVSHTVPIYEGYALPHAILR 609
              ++Y+A  Q+++ LY + R            +V+D G   +H VP+   + L HAI R
Sbjct: 122 GFSSLYIAHPQSLVHLYEASRQPDSILSKTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKR 181

Query: 610 LDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           +DL G+  T+YL ++++ R  S     E  +V D KEKLC+V+LD  +++  A + ++L
Sbjct: 182 IDLGGKAFTNYLKELVSYR--SINVMDETFLVDDAKEKLCFVSLDLLRDLRLARNGNTL 238


>At3g12380.1 68416.m01543 actin/actin-like family protein similar to
           SP|P53946 Actin-like protein ARP5 {Saccharomyces
           cerevisiae}; contains Pfam profile PF00022: Actin
          Length = 724

 Score =  111 bits (266), Expect = 7e-25
 Identities = 69/231 (29%), Positives = 117/231 (50%), Gaps = 11/231 (4%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD   S       
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGDLDPSMMKYFDC 77

Query: 280 -----KYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
                + P +  +V  ++ ME I  + F       +  +HP+L+TE   NP  +R KM +
Sbjct: 78  TRSGPRSPFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMAE 137

Query: 442 IMFETFNTPAMYVAIQAVLS-----LYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIL 606
           ++FET+  PA+   + A  S     L+   +  GIVL  G   +H++P  +G  +     
Sbjct: 138 LLFETYGVPAVAFGVDAAFSYKYNQLHGICKKDGIVLCPGFTTTHSIPFVDGEPIYKGSS 197

Query: 607 RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           R ++ G  +TDYL ++L+ +    ++    E   D+K + CY+A D+  E+
Sbjct: 198 RTNIGGYHVTDYLKQLLSLKYPFHSSRFTWEKAEDLKLEHCYIAPDYASEI 248


>At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical
           to actin-related protein 7 (ARP7) [Arabidopsis thaliana]
           GI:21427469; contains Pfam profile PF00022: Actin
          Length = 363

 Score =  104 bits (249), Expect = 8e-23
 Identities = 78/218 (35%), Positives = 105/218 (48%), Gaps = 2/218 (0%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           ALVVD GS   KAG A  D +P  + PS + R      MV  G   +   D   +    +
Sbjct: 3   ALVVDAGSKFLKAGAAIPDQSPAMIIPSQMKR------MVDDGSSSA---DNPTTVFEDV 53

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMF 450
           TL  PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA RE++ Q+MF
Sbjct: 54  TLD-PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQLVQLMF 112

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           ETFN    Y + QAVLSLYA GR +G  +D G G     P+ EG     A  R +L G +
Sbjct: 113 ETFNVSGFYASEQAVLSLYAVGRISGCTVDIGHGKIDIAPVLEGAVQHIASKRFELGGTE 172

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD 744
           LT    + L +   S   +     V  +KE+    A D
Sbjct: 173 LTKLFAQELGKTNPSMNLSMSD--VEKLKEQYANCAED 208


>At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identical
           to actin-related protein 5 (ARP5) GI:21489922 from
           [Arabidopsis thaliana]
          Length = 145

 Score =  104 bits (249), Expect = 8e-23
 Identities = 55/132 (41%), Positives = 79/132 (59%), Gaps = 16/132 (12%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG---------------M 219
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS+VG     G+ +                 
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAIDGNGMDIDDAANTTEDAKESDKEK 64

Query: 220 GQKDSYVGDEAQS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 396
           G++  Y G +A + +R  + +  P + GIVT+WD ++ +W H F N L + P EHP+LL 
Sbjct: 65  GKRKLYTGSQALNFRRDQMEILSPTKDGIVTDWDMVDNVWDHAFRNCLMIDPTEHPMLLA 124

Query: 397 EAPLNPKANREK 432
           E PLN +  REK
Sbjct: 125 EPPLNSQQQREK 136


>At5g56180.2 68418.m07009 actin-related protein, putative (ARP8)
           strong similarity to actin-related protein 8A (ARP8)
           [Arabidopsis thaliana] GI:21427473; contains Pfam
           profile PF00022: Actin; supporting cDNA
           gi|21427470|gb|AF507916.1|
          Length = 387

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 50/157 (31%), Positives = 82/157 (52%), Gaps = 11/157 (7%)
 Frame = +1

Query: 343 TFYNELRVAPEEHPVLLTEAPL-------NPKANREKMTQIMFETF---NTPAMYVAIQA 492
           T +  ++V P   P++++  PL       + KA+R ++   +F      N PA+    QA
Sbjct: 182 TIFTRMQVKPSMQPIVVS-LPLCHFDDTESAKASRRQLKTAIFNVLFDMNVPAVCAVNQA 240

Query: 493 VLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPH-AILRLDLAGRDLTDYLMKILTERG 669
           VL+LYA+ RT+GIV++ G  V   +PI  G  +    +  +      LT +L + + E  
Sbjct: 241 VLALYAARRTSGIVVNIGFQVITILPILHGKVMRQVGVEVIGFGALKLTGFLKEKMQENN 300

Query: 670 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSS 780
            SF +      VR +KEKLCYVALD++ E++    +S
Sbjct: 301 ISFQSL---YTVRTLKEKLCYVALDYKAELSKDTQAS 334


>At5g56180.1 68418.m07008 actin-related protein, putative (ARP8)
           strong similarity to actin-related protein 8A (ARP8)
           [Arabidopsis thaliana] GI:21427473; contains Pfam
           profile PF00022: Actin; supporting cDNA
           gi|21427470|gb|AF507916.1|
          Length = 471

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 50/157 (31%), Positives = 82/157 (52%), Gaps = 11/157 (7%)
 Frame = +1

Query: 343 TFYNELRVAPEEHPVLLTEAPL-------NPKANREKMTQIMFETF---NTPAMYVAIQA 492
           T +  ++V P   P++++  PL       + KA+R ++   +F      N PA+    QA
Sbjct: 182 TIFTRMQVKPSMQPIVVS-LPLCHFDDTESAKASRRQLKTAIFNVLFDMNVPAVCAVNQA 240

Query: 493 VLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPH-AILRLDLAGRDLTDYLMKILTERG 669
           VL+LYA+ RT+GIV++ G  V   +PI  G  +    +  +      LT +L + + E  
Sbjct: 241 VLALYAARRTSGIVVNIGFQVITILPILHGKVMRQVGVEVIGFGALKLTGFLKEKMQENN 300

Query: 670 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSS 780
            SF +      VR +KEKLCYVALD++ E++    +S
Sbjct: 301 ISFQSL---YTVRTLKEKLCYVALDYKAELSKDTQAS 334


>At3g19430.1 68416.m02464 late embryogenesis abundant
           protein-related / LEA protein-related similar to late
           embryogenesis abundant protein [Picea glauca] GI:1350543
          Length = 559

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           S  PP  +PS P    T PV PP    TP+  SPTP P +    +PTPS
Sbjct: 98  SPPPPTPTPSVPSP--TPPVSPPPPTPTPSVPSPTP-PVSPPPPTPTPS 143



 Score = 36.7 bits (81), Expect = 0.018
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           S  PP  +PS P    T PV PP    TP+  SPTP P +    +PTPS
Sbjct: 116 SPPPPTPTPSVPSP--TPPVSPPPPTPTPSVPSPTP-PVSPPPPTPTPS 161



 Score = 35.5 bits (78), Expect = 0.040
 Identities = 21/46 (45%), Positives = 25/46 (54%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP  +PS P    T PV PP    TP+  SPTP P +    +PTPS
Sbjct: 83  PPPPTPSVPSP--TPPVSPPPPTPTPSVPSPTP-PVSPPPPTPTPS 125



 Score = 35.5 bits (78), Expect = 0.040
 Identities = 21/48 (43%), Positives = 23/48 (47%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           S  PP  +PS P    T PV PP    TP+  SPTP   T    SP P
Sbjct: 134 SPPPPTPTPSVPSP--TPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPP 179



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 4/52 (7%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTP----CPSTKDTHSPTP 601
           S  PP  +PS P      P  P  S  +P  V+PTP     PS  D  +PTP
Sbjct: 182 SPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDV-TPTP 232



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 28/88 (31%), Positives = 32/88 (36%), Gaps = 3/88 (3%)
 Frame = +2

Query: 341 IPSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVV 520
           +PS    VSPP  T + S                  S  S  PP   P+ P      PV 
Sbjct: 126 VPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP-SVPSPTPPV--PTDPMPSPPPPVS 182

Query: 521 PPVSCWTPATVSP---TPCPSTKDTHSP 595
           PP    TP+  SP   TP P T    SP
Sbjct: 183 PPPPTPTPSVPSPPDVTPTPPTPSVPSP 210


>At5g43500.2 68418.m05318 expressed protein
          Length = 584

 Score = 35.1 bits (77), Expect = 0.054
 Identities = 21/92 (22%), Positives = 46/92 (50%)
 Frame = +1

Query: 379 HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVS 558
           H V++     + +  +E +T ++ E +   A+ V  + + +++ +G TT  +++ G   S
Sbjct: 238 HAVIVVPETFDTREIKEMLTIVLGELYFNSAV-VHQEGLSAVFGNGLTTACIVNIGAQTS 296

Query: 559 HTVPIYEGYALPHAILRLDLAGRDLTDYLMKI 654
             V + +G +LP+    L   G D+   L+ I
Sbjct: 297 TVVCVEDGVSLPNTEKILPFGGEDICRCLLWI 328


>At5g43500.1 68418.m05319 expressed protein
          Length = 596

 Score = 35.1 bits (77), Expect = 0.054
 Identities = 21/92 (22%), Positives = 46/92 (50%)
 Frame = +1

Query: 379 HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVS 558
           H V++     + +  +E +T ++ E +   A+ V  + + +++ +G TT  +++ G   S
Sbjct: 250 HAVIVVPETFDTREIKEMLTIVLGELYFNSAV-VHQEGLSAVFGNGLTTACIVNIGAQTS 308

Query: 559 HTVPIYEGYALPHAILRLDLAGRDLTDYLMKI 654
             V + +G +LP+    L   G D+   L+ I
Sbjct: 309 TVVCVEDGVSLPNTEKILPFGGEDICRCLLWI 340


>At1g20130.1 68414.m02518 family II extracellular lipase, putative
           contains Pfam profile PF00657: GDSL-like
           Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566)
          Length = 1006

 Score = 35.1 bits (77), Expect = 0.054
 Identities = 19/42 (45%), Positives = 22/42 (52%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSP 595
           PC SP KP +   +PV P      PA  +PTP PS K   SP
Sbjct: 97  PCPSPPKPPAPTPKPVPPHGPPPKPAP-APTPAPSPKPAPSP 137



 Score = 31.1 bits (67), Expect = 0.87
 Identities = 15/45 (33%), Positives = 19/45 (42%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           P   PS P     +PV PP    TP    P P P  +   +P P+
Sbjct: 48  PSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPA 92



 Score = 31.1 bits (67), Expect = 0.87
 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 1/49 (2%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATV-SPTPCPSTKDTHSPTPSCV 610
           PP   P  P     +P  PP     P     P PCPS     +PTP  V
Sbjct: 64  PPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPV 112



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 17/48 (35%), Positives = 21/48 (43%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           T  P   P  P    ++PV PP     P   SP P P  K   +P+PS
Sbjct: 5   TPDPSPKPVAPPGPSSKPVAPPGPSPCP---SPPPKPQPKPPPAPSPS 49


>At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical
           to gi|10880495|gb|AAG24277
          Length = 176

 Score = 34.7 bits (76), Expect = 0.071
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 7/56 (12%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVS------PTPCPSTK-DTHSPTPS 604
           +T PP  SP  P +       PPV+   PA ++      P P P+TK D+ SP+PS
Sbjct: 85  ATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPS 140



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 2/49 (4%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVV--PPVSCWTPATVSPTPCPSTKDTHSPTP 601
           T PP  +P+ P      P    PPVS   P T SP P  +     +P P
Sbjct: 24  TSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72



 Score = 27.9 bits (59), Expect = 8.1
 Identities = 14/48 (29%), Positives = 17/48 (35%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           S  PP T+   P +    P  PP    +P   SP P         P P
Sbjct: 49  SAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP 96


>At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical
           to gi|10880495|gb|AAG24277
          Length = 191

 Score = 34.7 bits (76), Expect = 0.071
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 7/56 (12%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVS------PTPCPSTK-DTHSPTPS 604
           +T PP  SP  P +       PPV+   PA ++      P P P+TK D+ SP+PS
Sbjct: 85  ATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPS 140



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 2/49 (4%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVV--PPVSCWTPATVSPTPCPSTKDTHSPTP 601
           T PP  +P+ P      P    PPVS   P T SP P  +     +P P
Sbjct: 24  TSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72



 Score = 27.9 bits (59), Expect = 8.1
 Identities = 14/48 (29%), Positives = 17/48 (35%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           S  PP T+   P +    P  PP    +P   SP P         P P
Sbjct: 49  SAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP 96


>At1g51090.1 68414.m05744 heavy-metal-associated domain-containing
           protein  contains Pfam profile PF00403:
           Heavy-metal-associated domain
          Length = 171

 Score = 34.7 bits (76), Expect = 0.071
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +2

Query: 464 RPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVW 613
           +PP   P  P  + T P   P     PA V P P P    + +P P  +W
Sbjct: 79  KPPQPQPQPP-QKPTAPAPAPAQAQAPALVRPAPVPVLVSSSAPQPMPMW 127


>At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase
           family protein similar to laccase [Pinus
           taeda][GI:13661201], lac110 laccase, Populus
           trichocarpa, EMBL:PTY13773
          Length = 584

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = -1

Query: 221 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 84
           P P I P  RGL   +G T+  +SSPA+P + +P  +ST +  TS+
Sbjct: 290 PTPDIKP-TRGLIVYQGATS--SSSPAEPLMPVPNDMSTAHRFTSN 332


>At4g18670.1 68417.m02762 leucine-rich repeat family protein /
           extensin family protein similar to extensin-like protein
           [Lycopersicon esculentum] gi|5917664|gb|AAD55979;
           contains leucine-rich repeats, Pfam:PF00560; contains
           proline rich extensin domains, INTERPRO:IPR002965
          Length = 839

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 23/48 (47%), Positives = 24/48 (50%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           S  PP T PS P S  T P  PP S  +P   SP P P T  T  PTP
Sbjct: 526 SPSPPITVPSPP-STPTSPGSPP-SPSSPTPSSPIPSPPTPST-PPTP 570



 Score = 31.5 bits (68), Expect = 0.66
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTR-PVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           C+  S+ PP    S  C R TR PVV P    TP+     P PS     SP+P
Sbjct: 384 CAAFSSLPPVDCGSFGCGRSTRPPVVVPSPPTTPSPGGSPPSPSI----SPSP 432



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 2/53 (3%)
 Frame = +2

Query: 458 STRPPCTSPSKPC--SRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCV 610
           STRPP   PS P   S    P  P +S   P TV   P   +     P+PS V
Sbjct: 403 STRPPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIV 455



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 17/52 (32%), Positives = 22/52 (42%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           S  +T  P  SP  P    + P+  P    TP +    P PS+    SP PS
Sbjct: 509 SSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPS 560


>At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid
           transfer protein (LTP) family protein similar to
           SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein
           Lycopersicon esculentum, proline-rich cell wall protein
           [Medicago sativa] GI:3818416; contains Pfam profile
           PF00234 Protease inhibitor/seed storage/LTP family
          Length = 334

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 17/49 (34%), Positives = 21/49 (42%)
 Frame = +2

Query: 464 RPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCV 610
           +PP T    P    T PVV P +   P    PTP P      +PTP  +
Sbjct: 157 KPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVI 205



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 2/53 (3%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSR-CTRPVVPPVSCWTPATVS-PTPCPSTKDTHSPTPSCV 610
           +T+PP ++P  P  +    P  PP    TP  V+ PTP P      +PTP  V
Sbjct: 143 TTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVV 195



 Score = 32.3 bits (70), Expect = 0.38
 Identities = 17/48 (35%), Positives = 21/48 (43%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCV 610
           PP  +P  P    T PV+ P +   P    PTP P      +PTP  V
Sbjct: 192 PPVVTPPTP----TPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVV 235



 Score = 31.9 bits (69), Expect = 0.50
 Identities = 16/48 (33%), Positives = 21/48 (43%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCV 610
           PP  +P  P    T PV+ P +   P    PTP P      +PTP  +
Sbjct: 172 PPVVTPPTP----TPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVI 215



 Score = 31.9 bits (69), Expect = 0.50
 Identities = 18/48 (37%), Positives = 21/48 (43%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCV 610
           PP  +P  P    T PVV P +   P    PTP P      +PTP  V
Sbjct: 182 PPVITPPTP----TPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVV 225



 Score = 31.5 bits (68), Expect = 0.66
 Identities = 16/45 (35%), Positives = 20/45 (44%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           PP  +P  P    T PV+ P +   P    PTP P      +PTP
Sbjct: 202 PPVITPPTP----TPPVITPPTPTPPVVTPPTPTPPVVTPPTPTP 242



 Score = 31.1 bits (67), Expect = 0.87
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCV 610
           K  T+PP ++P  P ++      PP S   P    P P P    T +PTP  V
Sbjct: 129 KPPTKPPPSTPKPPTTK------PPPSTPKPPHHKPPPTPCPPPTPTPTPPVV 175



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 2/49 (4%)
 Frame = +2

Query: 464 RPPCTSP--SKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           +PP   P    P S    P  PP S   P T  P P       H P P+
Sbjct: 113 KPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPT 161



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 16/49 (32%), Positives = 20/49 (40%)
 Frame = +2

Query: 464 RPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCV 610
           +PP T P     +      PP  C  P T  PTP P      +PTP  +
Sbjct: 140 KPPTTKPPPSTPKPPHHKPPPTPC-PPPT--PTPTPPVVTPPTPTPPVI 185



 Score = 28.3 bits (60), Expect = 6.1
 Identities = 15/37 (40%), Positives = 17/37 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPST 577
           PP  +P  P    T PVV P +   P    PTP P T
Sbjct: 212 PPVITPPTP----TPPVVTPPTPTPPVVTPPTPTPPT 244


>At3g19020.1 68416.m02415 leucine-rich repeat family protein /
           extensin family protein similar to extensin-like protein
           [Lycopersicon esculentum] gi|5917664|gb|AAD55979;
           contains leucine-rich repeats, Pfam:PF00560; contains
           proline rich extensin domains, INTERPRO:IPR002965
          Length = 956

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 19/50 (38%), Positives = 25/50 (50%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           HS  PP  SP  P    + P  PPV    P  V+P P  ++   ++PTPS
Sbjct: 793 HSPPPPVHSPPPPSPIYSPP--PPVFSPPPKPVTPLPPATSPMANAPTPS 840



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTP---CPSTKDTHSPTP 601
           HS  PP  SP  P      P  P  S   P   SP P    P     HSP P
Sbjct: 725 HSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPP 776


>At3g05690.1 68416.m00636 CCAAT-binding transcription factor
           (CBF-B/NF-YA) family protein contains Pfam profile:
           PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA)
           subunit B
          Length = 295

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 18/61 (29%), Positives = 28/61 (45%)
 Frame = +3

Query: 411 PQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRT 590
           P   + ED   +V + Q+   +RR  SRA A  V    +  +  R+  + H  HL  +R 
Sbjct: 128 PLNMETEDSTIYVNSKQYHGIIRRRQSRAKAAAVLDQKKLSSRCRKPYMHHSRHLHALRR 187

Query: 591 P 593
           P
Sbjct: 188 P 188


>At3g24550.1 68416.m03083 protein kinase family protein contains
           Pfam domain PF00069: Protein kinase domain
          Length = 652

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 3/48 (6%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATV---SPTPCPSTKDTHSPTPS 604
           P  SP  P +  T    PP +   P T    SP P PST  T SP PS
Sbjct: 11  PSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNST-SPPPS 57



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 1/50 (2%)
 Frame = +2

Query: 458 STRPPCTSP-SKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           S+ PP T+P S P S  T    PP S   P ++ P   P +     P PS
Sbjct: 32  SSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPS 81



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 21/51 (41%), Positives = 23/51 (45%), Gaps = 1/51 (1%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTP-CPSTKDTHSPT 598
           S +ST PP   PS P      P  PP S  TP    P+P  P T    SPT
Sbjct: 48  STNSTSPP---PSSPLPPSLPPPSPPGSL-TPPLPQPSPSAPITPSPPSPT 94


>At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid
           transfer protein (LTP) family protein similar to
           SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein
           Lycopersicon esculentum, proline-rich cell wall protein
           [Medicago sativa] GI:3818416; contains Pfam profile
           PF00234 Protease inhibitor/seed storage/LTP family
          Length = 428

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 1/54 (1%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSP-TPCPSTKDTHSPTPSCVWT*PV 625
           PP  +P  P     +P  PPV    P T +P  PCP    T  P P    T P+
Sbjct: 130 PPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCPI 183



 Score = 31.9 bits (69), Expect = 0.50
 Identities = 17/48 (35%), Positives = 19/48 (39%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
           H+ +PP   P  P   C  P   P     P TV P P P  K    PT
Sbjct: 59  HTPKPPTVKPPPPYIPCPPPPYTP----KPPTVKPPPPPYVKPPPPPT 102



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 1/50 (2%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPP-VSCWTPATVSPTPCPSTKDTHSPTP 601
           ++ +PP   P  P     +P  PP V    P  V P P P+ K    PTP
Sbjct: 80  YTPKPPTVKPPPP--PYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127


>At1g12040.1 68414.m01390 leucine-rich repeat family protein /
           extensin family protein (LRX1) similar to extensin-like
           protein [Lycopersicon esculentum]
           gi|5917664|gb|AAD55979; contains leucine-rich repeats,
           Pfam:PF00560; contains proline rich extensin domains,
           INTERPRO:IPR002965
          Length = 744

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 26/61 (42%), Positives = 29/61 (47%), Gaps = 5/61 (8%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPS----TKDTHS-PTPSCVWT*P 622
           S  PP  SP  PC   + P  PPV  + P T SP P PS       T S P PS V+  P
Sbjct: 521 SPPPPPPSPPPPCPESSPP--PPVVYYAPVTQSPPP-PSPVYYPPVTQSPPPPSPVYYPP 577

Query: 623 V 625
           V
Sbjct: 578 V 578



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 18/56 (32%), Positives = 26/56 (46%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           +S  PP +S   P  R   P  PP S  +P+  +  P P    + SP P  V++ P
Sbjct: 422 YSPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPP--PPSPSPPPPYVYSSP 475


>At1g10620.1 68414.m01204 protein kinase family protein contains
           serine/threonine protein kinases active-site signature,
           PROSITE:PS00108
          Length = 718

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 1/50 (2%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPP-VSCWTPATVSPTPCPSTKDTHSPTPS 604
           +T+PP TSP  P S  T+   PP  +   P    P   P      SP PS
Sbjct: 40  TTQPPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPS 89


>At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein
           contains Pfam PF01422: NF-X1 type zinc finger; similar
           to transcriptional repressor NF-X1 (SP:Q12986) [Homo
           sapiens]; similar to EST gb|T21002
          Length = 1188

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 6/53 (11%)
 Frame = +2

Query: 467 PPC-----TSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDT-HSPTPSC 607
           PPC     T  +  C R + P  PP+SC TP      PCP  +   HS T  C
Sbjct: 626 PPCLEMIFTDLTCACGRTSIP--PPLSCGTPVPSCQLPCPIPQPCGHSDTHGC 676


>At4g27850.1 68417.m03999 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965
          Length = 577

 Score = 32.3 bits (70), Expect = 0.38
 Identities = 19/44 (43%), Positives = 20/44 (45%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           P  SP  P S    P  PP S  TP   SP P P    + SPTP
Sbjct: 217 PLPSPG-PDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTP 259



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = +2

Query: 467 PPCTSPSK-PCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           PP +SP+  P S    P  PP    TP   SP P P   D+  P+P
Sbjct: 233 PPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPG-PDSPLPSP 277


>At4g13340.1 68417.m02084 leucine-rich repeat family protein /
           extensin family protein similar to extensin-like protein
           [Lycopersicon esculentum] gi|5917664|gb|AAD55979;
           contains leucine-rich repeats, Pfam:PF00560; contains
           proline rich extensin domains, INTERPRO:IPR002965
          Length = 760

 Score = 32.3 bits (70), Expect = 0.38
 Identities = 19/49 (38%), Positives = 22/49 (44%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           +S+ PP  SP+     CTRP  PP     P   SP P P      SP P
Sbjct: 518 YSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPP-PEPYYYSSPPP 565



 Score = 31.5 bits (68), Expect = 0.66
 Identities = 16/48 (33%), Positives = 20/48 (41%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           S RPP  +P  P S  + P   P+    P   SP P       +SP P
Sbjct: 393 SPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPP 440



 Score = 28.3 bits (60), Expect = 6.1
 Identities = 16/47 (34%), Positives = 19/47 (40%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           T PP  SP  P      P  PP   ++P    P P P     +SP P
Sbjct: 424 TSPPPPSPPPPVYSPPPPPPPPPPVYSPP--PPPPPPPPPPVYSPPP 468



 Score = 27.9 bits (59), Expect = 8.1
 Identities = 15/51 (29%), Positives = 21/51 (41%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
           C    +RPP    S  C R   P  P V+   P ++   P P+   +  PT
Sbjct: 372 CKAFLSRPPVNCGSFSCGRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPT 422


>At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-related
           similar to glucan endo-1,3-beta-glucosidase precursor
           SP:P52409 from [Triticum aestivum]
          Length = 330

 Score = 32.3 bits (70), Expect = 0.38
 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 1/37 (2%)
 Frame = +2

Query: 458 STRPPCT-SPSKPCSRCTRPVVPPVSCWTPATVSPTP 565
           +T PP T +P+ P +  T P+VPPV+   P T++P P
Sbjct: 47  ATFPPVTITPTNPAT--TVPIVPPVTTIPPPTLTPPP 81


>At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly
           identical to splicing factor RSZ33 [Arabidopsis
           thaliana] GI:9843663; contains Pfam profiles PF00076:
           RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain),
           PF00098: Zinc knuckle
          Length = 249

 Score = 31.9 bits (69), Expect = 0.50
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 477 RRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSR 629
           RR PSR+L+ R RSY R R+ +RRR    R+   R R+P R   S   R+R
Sbjct: 121 RRSPSRSLS-RSRSYSRSRSPVRRR---ERSVEERSRSPKRMDDSLSPRAR 167


>At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly
           identical to splicing factor RSZ33 [Arabidopsis
           thaliana] GI:9843663; contains Pfam profiles PF00076:
           RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain),
           PF00098: Zinc knuckle
          Length = 260

 Score = 31.9 bits (69), Expect = 0.50
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 477 RRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSR 629
           RR PSR+L+ R RSY R R+ +RRR    R+   R R+P R   S   R+R
Sbjct: 132 RRSPSRSLS-RSRSYSRSRSPVRRR---ERSVEERSRSPKRMDDSLSPRAR 178


>At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly
           identical to splicing factor RSZ33 [Arabidopsis
           thaliana] GI:9843663; contains Pfam profiles PF00076:
           RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain),
           PF00098: Zinc knuckle
          Length = 290

 Score = 31.9 bits (69), Expect = 0.50
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 477 RRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSR 629
           RR PSR+L+ R RSY R R+ +RRR    R+   R R+P R   S   R+R
Sbjct: 162 RRSPSRSLS-RSRSYSRSRSPVRRR---ERSVEERSRSPKRMDDSLSPRAR 208


>At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19)
           non-consensus splice site at the intron:exon boundary
           (AT:exon)
          Length = 247

 Score = 31.9 bits (69), Expect = 0.50
 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 2/50 (4%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVV--PPVSCWTPATVSPTPCPSTKDTHSPTP 601
           +T PP T+ + P +    P    PPVS   P     TP P+   T  P P
Sbjct: 36  TTAPPPTTAAPPTTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAP 85



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           T PP  +P+ P +    PV+ P    TP    P   P++  T SP P
Sbjct: 72  TPPPAVTPTSPPAPKVAPVISPA---TPPPQPPQSPPASAPTVSPPP 115


>At5g38560.1 68418.m04662 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 681

 Score = 31.5 bits (68), Expect = 0.66
 Identities = 17/46 (36%), Positives = 21/46 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP  SPS P    T P  PP    +P   +P+P   T     P+PS
Sbjct: 118 PPDASPSPPAPTTTNP--PPKPSPSPPGETPSPPGETPSPPKPSPS 161



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +2

Query: 467 PPCTSPSKPC-SRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           PP  SPS P  +  T P  PP +  +P + +PT  PST     PTP
Sbjct: 155 PPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTD-PSTL-APPPTP 198



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 20/55 (36%), Positives = 24/55 (43%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           S+ PP    S P    + P  PPV    P TV+ +P P      SP PS   T P
Sbjct: 53  SSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVV-IASPPPSTPATTP 106



 Score = 28.3 bits (60), Expect = 6.1
 Identities = 17/48 (35%), Positives = 20/48 (41%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           S+ PP +SP       T P     S   P  V  +P PST  T  P P
Sbjct: 62  SSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAP 109


>At4g33970.1 68417.m04820 leucine-rich repeat family protein /
           extensin family protein similar to extensin-like protein
           [Lycopersicon esculentum] gi|5917664|gb|AAD55979;
           contains leucine-rich repeats, Pfam:PF00560; contains
           proline rich extensin domains, INTERPRO:IPR002965
          Length = 699

 Score = 31.5 bits (68), Expect = 0.66
 Identities = 18/49 (36%), Positives = 20/49 (40%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           HS  PP    S P    + P  PPV    P   SP P  S    +SP P
Sbjct: 594 HSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPP 642



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTP--CPSTKDTHSPTP 601
           HS  PP  SP  P      P  PPV    P   SP P         HSP P
Sbjct: 541 HSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPP 591



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 1/50 (2%)
 Frame = +2

Query: 455 HSTRPPCTSP-SKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           H   P  T+P  KP    T PV  P    T     P+P P+T   H P+P
Sbjct: 426 HKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTT-PVHEPSP 474


>At3g50580.1 68416.m05532 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965
          Length = 265

 Score = 31.5 bits (68), Expect = 0.66
 Identities = 29/91 (31%), Positives = 32/91 (35%), Gaps = 3/91 (3%)
 Frame = +2

Query: 341 IPSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVV 520
           IPST S  SPP      S                    H T  P  SPS P +    P  
Sbjct: 81  IPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPT--PKKSPSPPPTPSLPPPA 138

Query: 521 PPVSCWTPATVSPTP---CPSTKDTHSPTPS 604
           P  S  TP+   PTP    P     HS +PS
Sbjct: 139 PKKSPSTPSLPPPTPKKSPPPPPSHHSSSPS 169


>At1g32190.1 68414.m03959 expressed protein
          Length = 422

 Score = 31.5 bits (68), Expect = 0.66
 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 1/42 (2%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRC-TRPVVPPVSCWTPATVSPTPC 568
           C K S    C  P+  CS C  +P  P  SCW       T C
Sbjct: 343 CKKPSCVSSCCCPTFKCSSCFGKPKCPKCSCWKCLKCPDTEC 384


>At5g17420.1 68418.m02044 cellulose synthase, catalytic subunit
           (IRX3) identical to gi:5230423
          Length = 1026

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
 Frame = +3

Query: 399 GSPQPQGQQREDDPDHVR---NIQHARHVRRHPSRALAVRVRSYHR 527
           GSP+ +G + E+D D +    NI+H +   +H + A+     SY R
Sbjct: 91  GSPRVEGDEDEEDIDDIEYEFNIEHEQDKHKHSAEAMLYGKMSYGR 136


>At4g25620.1 68417.m03690 hydroxyproline-rich glycoprotein family
           protein contains proline-rich extensin domains,
           INTERPRO:IPR002965; Common family member At5g52430
           [Arabidopsis thaliana];
          Length = 449

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 17/51 (33%), Positives = 23/51 (45%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
           CS     PP      P +  T+PV PPV  ++  T  P+  P T    SP+
Sbjct: 115 CSLTVNEPPSAFTIGPYAHETQPVTPPV--FSAFTTEPSTAPFTPPPESPS 163


>At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to
           protodermal factor 1 [Arabidopsis thaliana]
           gi|4929130|gb|AAD33869
          Length = 306

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 9/58 (15%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPC---------SRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           H T P  T PS  C         S  + P  PP    TP+T S TP P T  +H+PTP
Sbjct: 45  HGTPPSHTPPSSNCGSPPYDPSPSTPSHPS-PPSHTPTPSTPSHTPTPHT-PSHTPTP 100


>At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to
           protodermal factor 1 [Arabidopsis thaliana]
           gi|4929130|gb|AAD33869
          Length = 306

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 9/58 (15%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPC---------SRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           H T P  T PS  C         S  + P  PP    TP+T S TP P T  +H+PTP
Sbjct: 45  HGTPPSHTPPSSNCGSPPYDPSPSTPSHPS-PPSHTPTPSTPSHTPTPHT-PSHTPTP 100


>At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid
           transfer protein (LTP) family protein similar to pEARLI
           1 (Accession No. L43080): an Arabidopsis member of a
           conserved gene family (PGF95-099), Plant Physiol. 109
           (4), 1497 (1995); contains Pfam protease inhibitor/seed
           storage/LTP family domain PF00234
          Length = 177

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 16/37 (43%), Positives = 17/37 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPST 577
           P   SPS P      P VP  S  TP+  SP P P T
Sbjct: 47  PKYPSPSIPSPSVPTPSVPTPSVPTPSVPSPNPTPVT 83



 Score = 28.3 bits (60), Expect = 6.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = +2

Query: 479 SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCV 610
           SP  P  +   P +P  S  TP+   PTP   T    SP P+ V
Sbjct: 41  SPKVPSPKYPSPSIPSPSVPTPSV--PTPSVPTPSVPSPNPTPV 82


>At3g28790.1 68416.m03593 expressed protein 
          Length = 608

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSP-TPCPSTKDTHSPTPS 604
           S  +T    T  S   S    P   P S  TP+T +P TP PST    +PTPS
Sbjct: 258 SSGNTYKDTTGSSSGASPSGSPTPTP-STPTPSTPTPSTPTPSTPTPSTPTPS 309


>At2g40070.1 68415.m04923 expressed protein
          Length = 607

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           S   T  P   PSK  SR + P   P++  + AT +  P  S     SP P+
Sbjct: 295 SSTPTSRPTLPPSKTISRSSTPTRRPIASASAATTTANPTISQIKPSSPAPA 346


>At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical
           to gi_3883126_gb_AAC77826
          Length = 135

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 15/48 (31%), Positives = 22/48 (45%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           +T PP  +P  P +       PP +   PAT  P+  PS  D  + +P
Sbjct: 41  ATPPPVATPP-PAATPAPATPPPAATPAPATTPPSVAPSPADVPTASP 87


>At1g62440.1 68414.m07044 leucine-rich repeat family protein /
           extensin family protein similar to extensin-like protein
           [Lycopersicon esculentum] gi|5917664|gb|AAD55979;
           contains leucine-rich repeats, Pfam:PF00560; contains
           proline rich extensin domains, INTERPRO:IPR002965
          Length = 826

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 22/60 (36%), Positives = 27/60 (45%), Gaps = 7/60 (11%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVV----PPVSCWTPATVSPTPCPST---KDTHSPTPSCVWT*PV 625
           PP T+   P      PV+    PP   ++P T SP P P       T SP PS V+  PV
Sbjct: 641 PPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPV 700



 Score = 28.3 bits (60), Expect = 6.1
 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 2/59 (3%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCP--STKDTHSPTPSCVWT*PV 625
           ++T+ P   P         P  PP   + P T SP P P   T    SP P  V+  PV
Sbjct: 613 YATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPV 671



 Score = 27.9 bits (59), Expect = 8.1
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           S  +T PP +S   P  R T P  PP S  +P+ V   P P     + P+P
Sbjct: 466 SFRATPPPPSSKMSPSFRATPP--PPSSKMSPS-VKAYPPPPPPPEYEPSP 513


>At5g14920.1 68418.m01750 gibberellin-regulated family protein
           similar to SP|P46689 Gibberellin-regulated protein 1
           precursor {Arabidopsis thaliana}; contains Pfam profile
           PF02704: Gibberellin regulated protein
          Length = 275

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 18/47 (38%), Positives = 21/47 (44%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
           + +PP TSP KP      P  PPV   +P    PT  P T     PT
Sbjct: 130 TVKPPTTSPVKP------PTTPPVQ--SPPVQPPTYKPPTSPVKPPT 168



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 18/51 (35%), Positives = 23/51 (45%)
 Frame = +2

Query: 464 RPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           +PP T+P       T PV PP   + P T +P   P+      PTP  V T
Sbjct: 165 KPPTTTPPVKPPTTTPPVQPPT--YNPPT-TPVKPPTAPPVKPPTPPPVRT 212


>At5g11990.1 68418.m01402 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965
          Length = 181

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 21/51 (41%), Positives = 26/51 (50%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           S+ ST P   SP  P S+ +  + PP S   P + SP P P  K  HSP P
Sbjct: 33  SECSTCPTICSP--PPSKPSPSMSPPPSPSLPLSSSPPPPPPHK--HSPPP 79


>At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid
           transfer protein (LTP) family protein similar to pEARLI
           1 (Accession No. L43080): an Arabidopsis member of a
           conserved gene family (PGF95-099), Plant Physiol. 109
           (4), 1497 (1995); contains Pfam protease inhibitor/seed
           storage/LTP family domain PF00234
          Length = 182

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 1/54 (1%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPT-PCPSTKDTHSPTPS 604
           C+      P  +P  P  +   P VP     TP+  SP+ P PS      P+P+
Sbjct: 30  CNPSPKPRPLPNPKVPSPKVPTPSVPSPYVPTPSVPSPSVPTPSVPSPSVPSPN 83


>At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor
           family protein low similarity to extensin [Volvox
           carteri] GI:21992
          Length = 312

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 17/49 (34%), Positives = 23/49 (46%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           S  PP +SPS        P  PP    +P++  P P PS+    S +PS
Sbjct: 37  SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP-PSSSPLSSLSPS 84



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 17/49 (34%), Positives = 23/49 (46%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           S  PP +SPS        P  PP    +P++  P P PS+    S +PS
Sbjct: 86  SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP-PSSSPLSSLSPS 133


>At1g49750.1 68414.m05579 leucine-rich repeat family protein
           contains leucine-rich repeats, Pfam:PF00560
          Length = 494

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPV-SCWTPATVSPTPCPSTKD 583
           C    + PPC  P  P      P +PP      PA   P P P T D
Sbjct: 70  CPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPD 116


>At1g49490.1 68414.m05547 leucine-rich repeat family protein /
           extensin family protein contains similarity to disease
           resistance protein GI:3894383 from [Lycopersicon
           esculentum]; contains leucine-rich repeats,
           Pfam:PF00560; contains proline rich extensin domains,
           INTERPRO:IPR002965
          Length = 847

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 19/56 (33%), Positives = 23/56 (41%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           +S  PP  SP  P    + P  P V    P   SP P       HSP P  V++ P
Sbjct: 550 YSPPPPVHSPPPPVY--SSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPP 603



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSR---CTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           HS  PP  SP  P            PP+   TP T +PTP  S++ T  PTPS
Sbjct: 623 HSPPPPVYSPPPPTFSPPPTHNTNQPPMGAPTP-TQAPTP--SSETTQVPTPS 672


>At1g11130.1 68414.m01274 leucine-rich repeat family protein /
           protein kinase family protein contains leucine
           rich-repeat (LRR) domains Pfam:PF00560,
           INTERPRO:IPR001611; contains similarity to leucine-rich
           repeat transmembrane protein kinase 2 [Zea mays]
           gi|3360291|gb|AAC27895
          Length = 768

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 1/53 (1%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTR-PVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           PP   P     R    P +PPVS   PA  +P      +    P+P  VW+ P
Sbjct: 252 PPVVDPPPATHRAPPVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSPPLVWSPP 304


>At1g16690.2 68414.m01999 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 20/63 (31%), Positives = 27/63 (42%)
 Frame = +1

Query: 244 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN 423
           D A      L++KY + H I + W +  +IW       L+  P   PV  T  P N    
Sbjct: 169 DAAGEALKYLSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP---PVNDTN-PYNVFRP 224

Query: 424 REK 432
           REK
Sbjct: 225 REK 227


>At1g16690.1 68414.m01998 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 20/63 (31%), Positives = 27/63 (42%)
 Frame = +1

Query: 244 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN 423
           D A      L++KY + H I + W +  +IW       L+  P   PV  T  P N    
Sbjct: 169 DAAGEALKYLSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP---PVNDTN-PYNVFRP 224

Query: 424 REK 432
           REK
Sbjct: 225 REK 227


>At5g56330.1 68418.m07031 carbonic anhydrase family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965;
           contains Pfam profile PF00194: Eukaryotic-type carbonic
           anhydrase
          Length = 350

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 19/54 (35%), Positives = 22/54 (40%), Gaps = 4/54 (7%)
 Frame = +2

Query: 452 KHSTRPPCTSPS-KPCSRCTRPVVPPVSCWTPATVSPTPC---PSTKDTHSPTP 601
           K   +P  T P  KP    T P   P    TP    P P    P+ K T +PTP
Sbjct: 52  KPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTP 105


>At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identical
           to gi|3883122|gb|AAC77824; supported by cDNA
           gi|3883121|gb|AF082299
          Length = 131

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +2

Query: 518 VPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           +PPV+  TP+ ++  P P  + T +PT S
Sbjct: 38  LPPVTAETPSPIASPPVPVNEPTPAPTTS 66


>At1g61080.1 68414.m06877 proline-rich family protein 
          Length = 907

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 1/51 (1%)
 Frame = +2

Query: 452 KHSTRPPCTSP-SKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           KH   PP T P  KP      P  PP    T     P P P  +   +P P
Sbjct: 488 KHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPP 538


>At5g61090.1 68418.m07665 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965;
           contains similarity to vegetative cell wall protein gp1
           [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420;
           common family members: At4g18570, At3g25690, At4g04980
           [Arabidopsis thaliana]
          Length = 344

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           TRP  T+PS   +  T  V  PVS   P +V+P+P  +   + +  P
Sbjct: 157 TRPTSTAPSPVSAHPTSVVPSPVSV-HPTSVAPSPVSACLTSEASKP 202


>At4g01985.1 68417.m00265 expressed protein
          Length = 579

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 17/45 (37%), Positives = 19/45 (42%)
 Frame = -3

Query: 600 GVGECVSFVDGHGVGDTVAGVQHDTGGTTGRVQREHGLDGDVHGG 466
           GVG  V    G  VG  V G    +GG +G      G  G V GG
Sbjct: 507 GVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGG 551


>At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to
           uclacyanin 3 GI:3395770 from [Arabidopsis thaliana];
           contains Pfam profile PF02298: Plastocyanin-like domain;
           identical to cDNA uclacyanin 3 (UCC3)GI:3395769
          Length = 222

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = +2

Query: 479 SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           SPS P S  + P  P     TP+T S  P P +  + S  PS
Sbjct: 124 SPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPS 165


>At2g15880.1 68415.m01820 leucine-rich repeat family protein /
           extensin family protein similar to extensin-like protein
           [Lycopersicon esculentum] gi|5917664|gb|AAD55979;
           contains leucine-rich repeats, Pfam:PF00560; contains
           proline rich extensin domains, INTERPRO:IPR002965
          Length = 727

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 19/49 (38%), Positives = 20/49 (40%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           HS  PP  SP  P    + P  PPV    P   SP P       HSP P
Sbjct: 600 HSPPPPVHSPPPPVY--SPPPPPPVHSPPPPVFSPPP-----PVHSPPP 641


>At1g02405.1 68414.m00187 proline-rich family protein contains
           proline-rich region, INTERPRO:IPR000694
          Length = 134

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 13/30 (43%), Positives = 17/30 (56%)
 Frame = +2

Query: 512 PVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           P  PP SC TP+   P+P P  K +  P+P
Sbjct: 53  PSPPPPSC-TPSPPPPSPPPPKKSSCPPSP 81


>At5g29020.1 68418.m03592 hypothetical protein
          Length = 847

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = +2

Query: 476 TSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT-PSCV 610
           ++P+KPC   T PV PP         +  P PS   + +PT PS V
Sbjct: 26  SNPAKPCGSRTLPVNPPYPTTGKRKRADPPKPSRGLSPNPTDPSGV 71


>At5g23150.1 68418.m02707 PWWP domain-containing protein identical to
            cDNA putative transcription factor (HUA2) GI:4868119;
            contains Pfam profile  PF00855:  PWWP domain
          Length = 1392

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = +2

Query: 467  PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCP 571
            PP + P  P +    P+ PP S   P  +SP P P
Sbjct: 1087 PPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSP 1121


>At4g34440.1 68417.m04894 protein kinase family protein contains
           Pfam domain, PF00069: Protein kinase domain
          Length = 670

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 15/44 (34%), Positives = 19/44 (43%), Gaps = 4/44 (9%)
 Frame = +2

Query: 479 SPSKPCSRCTRPVVPPVSCWTPATVSP----TPCPSTKDTHSPT 598
           +PS P    + PV PP    TP+  SP     P P   D  + T
Sbjct: 89  NPSPPAPEGSTPVTPPAPPQTPSNQSPERPTPPSPGANDDRNRT 132


>At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid
           transfer protein (LTP) family protein similar to
           hydroxyproline-rich glycoprotein DZ-HRGP from Volvox
           carteri f. nagariensis GP|6523547; contains Pfam profile
           PF00234 Protease inhibitor/seed storage/LTP family
          Length = 375

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 3/48 (6%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRP---VVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           PP T+P  P +    P   + PP+S   PA   P P  +T     P P
Sbjct: 99  PPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKP 146


>At4g01900.1 68417.m00250 P II nitrogen sensing protein (GLB I)
           identical to P II nitrogen sensing protein GLB I
           (GI:7268574) [Arabidopsis thaliana]; similar to nitrogen
           regulatory protein P-II (PII signal transducing protein)
           (SP:O30794) {Nostoc punctiforme}
          Length = 196

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 4/77 (5%)
 Frame = -1

Query: 581 PS*MGTVWETPSPESSTIPVVRPDAYSESTAWMATY-MAGVLNVSNMIWVIFSLLALGLR 405
           PS +  V ++PS  S  +PVV     S+       Y +  ++    +  V  +LL +G+R
Sbjct: 40  PSCLDLVTKSPSNNSRVLPVVSAQISSDYIPDSKFYKVEAIVRPWRIQQVSSALLKIGIR 99

Query: 404 GASVSRT---GCSSGAT 363
           G +VS     G   G+T
Sbjct: 100 GVTVSDVRGFGAQGGST 116


>At3g51290.1 68416.m05614 proline-rich family protein 
          Length = 602

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 7/56 (12%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVS------CWTPATVSPT-PCPSTKDTHSPTPSCVW 613
           PP  SPS P     RP  PP+S       WT  T S   P P       P PS  W
Sbjct: 68  PP--SPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPSSTW 121


>At3g19480.1 68416.m02469 D-3-phosphoglycerate dehydrogenase,
           putative / 3-PGDH, putative similar to SP:O04130 from
           [Arabidopsis thaliana]
          Length = 588

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = -1

Query: 332 IFSMSSQLVTIPCSMGYLRVRIPLLLCASS 243
           IFS SS+LVT P S+  +R R  ++L  SS
Sbjct: 10  IFSSSSRLVTTPSSVFPIRQRRRIILVTSS 39


>At2g23990.2 68415.m02866 plastocyanin-like domain-containing
           protein 
          Length = 226

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 4/43 (9%)
 Frame = +2

Query: 488 KPCSRCTRPVVPPVSCWTPAT---VSPTPCP-STKDTHSPTPS 604
           KP      P +PP    TPA      PTP P S+  T +P P+
Sbjct: 154 KPGPAAVTPTLPPKPSTTPAAPAPAPPTPSPKSSTSTMAPAPA 196


>At2g23990.1 68415.m02865 plastocyanin-like domain-containing
           protein 
          Length = 207

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 4/43 (9%)
 Frame = +2

Query: 488 KPCSRCTRPVVPPVSCWTPAT---VSPTPCP-STKDTHSPTPS 604
           KP      P +PP    TPA      PTP P S+  T +P P+
Sbjct: 135 KPGPAAVTPTLPPKPSTTPAAPAPAPPTPSPKSSTSTMAPAPA 177


>At2g22510.1 68415.m02670 hydroxyproline-rich glycoprotein family
           protein similar to proline-rich cell wall protein
           [Gossypium barbadense] gi|451544|gb|AAA79364; contains
           proline-rich extensin domains, INTERPRO:IPR002965
          Length = 124

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 15/46 (32%), Positives = 20/46 (43%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP T+   P    T P  PP +     T  P P PS++    P P+
Sbjct: 36  PPVTTTFPPLPTTTMPPFPPSTSLPQPTAFP-PLPSSQIPSLPNPA 80


>At2g22330.1 68415.m02649 cytochrome P450, putative similar to
           cytochrome P450 79B2 (SP:O81346) [Arabidopsis thaliana]
          Length = 543

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = -3

Query: 324 HVIPVSDDSVFDGVFEGQDTSFALCLISYIRVLLSH 217
           HVIPV+   +   +F+ QD  FA   ++Y + +LS+
Sbjct: 104 HVIPVTCPKIAREIFKQQDALFASRPLTYAQKILSN 139


>At1g54970.1 68414.m06278 proline-rich family protein similar to
           proline-rich protein GI:170048 from [Glycine max]
          Length = 335

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSP 595
           +K S  PP   P+      T+P +PP       + SP P  + K T++P
Sbjct: 153 NKPSLSPPVYKPTLSPPVYTKPTLPPPVYKKSPSYSPPPPFAPKPTYTP 201


>At1g02890.1 68414.m00256 AAA-type ATPase family protein contains
           Pfam domain, PF00004: ATPase, AAA family; similar to
           mitochondrial sorting protein 1 (MSP1) (TAT-binding
           homolog 4) (Swiss-Prot:P28737) [Saccharomyces
           cerevisiae]
          Length = 1252

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = +3

Query: 522 HRYRAGLRRRCL-PHRAHLRRIRTPPRHPASG 614
           + ++AG R R L P  + L  +R PPR PA+G
Sbjct: 601 YTFKAGDRVRFLGPSTSSLASLRAPPRGPATG 632


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,003,652
Number of Sequences: 28952
Number of extensions: 466716
Number of successful extensions: 2056
Number of sequences better than 10.0: 88
Number of HSP's better than 10.0 without gapping: 1570
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1958
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1775300800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).