SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0019
         (837 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g58250.1 68416.m06494 meprin and TRAF homology domain-contain...    31   0.95 
At1g43245.1 68414.m04985 expressed protein                             29   2.9  
At5g45230.1 68418.m05551 disease resistance protein (TIR-NBS-LRR...    29   5.1  
At3g22980.1 68416.m02898 elongation factor Tu family protein sim...    29   5.1  
At2g42180.1 68415.m05220 expressed protein                             28   8.8  
At2g12130.1 68415.m01306 hypothetical protein                          28   8.8  

>At3g58250.1 68416.m06494 meprin and TRAF homology domain-containing
           protein / MATH domain-containing protein similar to
           ubiquitin-specific protease 12 [Arabidopsis thaliana]
           GI:11993471; contains Pfam profile PF00917: MATH domain
          Length = 317

 Score = 31.1 bits (67), Expect = 0.95
 Identities = 19/67 (28%), Positives = 30/67 (44%)
 Frame = +1

Query: 157 KQWDLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVKPDTMKLIVNWSGKEFLRETWTRFVE 336
           K +  L +  +  D F+  G   +L  F +    K D + L ++ +  E L   W R  +
Sbjct: 16  KNFSSLQSEKIYSDQFVIDGCRWRLLAFPKGNDTKSDHLSLYLDVAESESLPCGWRRHAQ 75

Query: 337 DSFPIVN 357
            SF IVN
Sbjct: 76  FSFTIVN 82


>At1g43245.1 68414.m04985 expressed protein
          Length = 558

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 15/52 (28%), Positives = 27/52 (51%)
 Frame = +1

Query: 361 QEVMDVYLVANLKPTRPNRCYKFLAQHALRWEEDYVPHEVIRIVEPSYVGMN 516
           QE +D +L  N+ P       + +  H ++++ED  PH  +R+    YV +N
Sbjct: 321 QEAIDDFLSDNIDPKTCCEMIESVLHHGIQFKEDSQPH-CLRLHACHYVALN 371


>At5g45230.1 68418.m05551 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1231

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 21/80 (26%), Positives = 36/80 (45%)
 Frame = +1

Query: 88  KNLGCLIKNAKRKKHLVEHEQEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVKPD 267
           KNL   I+N++    ++     E  W L +   + E    G G N+KL +      +K D
Sbjct: 54  KNLFKRIENSEIALAVLSSRYTESHWCLQELVKMMECSMKGEGCNKKLLVIPIFYKLKID 113

Query: 268 TMKLIVNWSGKEFLRETWTR 327
           T+K +    G+  L + W +
Sbjct: 114 TVKELDGDFGRN-LWDLWRK 132


>At3g22980.1 68416.m02898 elongation factor Tu family protein similar
            to eukaryotic translation elongation factor 2
            GB:NP_001952 [Homo sapiens]
          Length = 1015

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +1

Query: 184  MVAEDPFLGPGKNQKLTLFKEIRSVKPDTMKLIVN 288
            M+ EDPF  P   +++  F +  SV P+T + ++N
Sbjct: 953  MLEEDPFFVPKTEEEIEEFGDGASVLPNTARKLIN 987


>At2g42180.1 68415.m05220 expressed protein
          Length = 166

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 14/56 (25%), Positives = 28/56 (50%)
 Frame = -1

Query: 834 TIVCKSTTHRI*RLINVLITMYSVLIRRTSEQRRVWCKLLYFENERNLN*DFLFFG 667
           T+     TH + RL+  L    SVLI  +   ++    ++++  + ++N   +FFG
Sbjct: 17  TLFINLITHSLYRLLRSLSRARSVLIEISKHNKKRLFMMMFYTTKSSMNQHNIFFG 72


>At2g12130.1 68415.m01306 hypothetical protein
          Length = 209

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = -3

Query: 406 VWV*GWRRGTRPSPLGRLQWGSCPQQNGSKFHAKTLC 296
           +W   WR    P  LGR  +G+C +     ++A+ LC
Sbjct: 170 LWNRSWRFVVSPDCLGRCSYGACCRNCFFYWYARELC 206


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,767,699
Number of Sequences: 28952
Number of extensions: 411326
Number of successful extensions: 1180
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1143
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1180
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1931371200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).