SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0017
         (851 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g01030.1 68417.m00140 pentatricopeptide (PPR) repeat-containi...    29   3.9  
At3g19580.1 68416.m02483 zinc finger (C2H2 type) protein 2 (AZF2...    29   5.2  
At1g31870.1 68414.m03917 expressed protein                             29   5.2  
At5g04510.1 68418.m00451 3-phosphoinositide-dependent protein ki...    28   9.1  
At3g10540.1 68416.m01265 3-phosphoinositide-dependent protein ki...    28   9.1  

>At4g01030.1 68417.m00140 pentatricopeptide (PPR) repeat-containing
           protein contains INTERPRO:IPR002885 PPR repeats
          Length = 500

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 13/33 (39%), Positives = 23/33 (69%), Gaps = 3/33 (9%)
 Frame = -2

Query: 109 SGEKLSGLCLRVNLLVEPFVAS---DGFDENGD 20
           SG+++ G CLR NL+ + +VA+   D + ++GD
Sbjct: 146 SGKEVHGFCLRKNLICDAYVATALVDMYGKSGD 178


>At3g19580.1 68416.m02483 zinc finger (C2H2 type) protein 2 (AZF2)
           identical to Cys2/His2-type zinc finger protein 2
           [Arabidopsis thaliana] gi|6009885|dbj|BAA85107
          Length = 273

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +3

Query: 273 KKKNNDDQRSRSPRYGDPIRPPDTPRSQNQPAGSE 377
           K+K +  QRS SP       P   P+SQNQ    E
Sbjct: 34  KRKRSKRQRSHSPSSSSSSPPRSRPKSQNQDLTEE 68


>At1g31870.1 68414.m03917 expressed protein
          Length = 561

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = +3

Query: 273 KKKNNDDQRSRSPRYGDPIRPPDTPRSQNQPAGSERDTPPTG 398
           KKK+ND    R  RY  P   P+  R  ++  GS  D  P G
Sbjct: 250 KKKSNDLSPPRRRRYHSP--SPEPARRSSKSFGSNADLSPPG 289


>At5g04510.1 68418.m00451 3-phosphoinositide-dependent protein
           kinase, putative similar to 3-phosphoinositide-dependent
           protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166
          Length = 491

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = -1

Query: 737 DGRFKYYLNLFSIT*MLCAVSVIKKITKNKIQLLL 633
           D R++ +L       M+ AV  ++KIT  K+QL+L
Sbjct: 387 DSRWQQFLEPGESVLMISAVKKLQKITSKKVQLIL 421


>At3g10540.1 68416.m01265 3-phosphoinositide-dependent protein
           kinase, putative similar to 3-phosphoinositide-dependent
           protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166
          Length = 486

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = -1

Query: 737 DGRFKYYLNLFSIT*MLCAVSVIKKITKNKIQLLL 633
           D R++ +L       M+ AV  ++KIT  K+QL+L
Sbjct: 382 DSRWQQFLEPGESVLMISAVKKLQKITSKKVQLIL 416


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,384,426
Number of Sequences: 28952
Number of extensions: 352744
Number of successful extensions: 912
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 866
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 911
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1980143200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).