SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0016
         (985 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g28290.2 68415.m03434 chromatin remodeling protein, putative ...    33   0.29 
At2g28290.1 68415.m03433 chromatin remodeling protein, putative ...    33   0.29 
At4g33230.1 68417.m04730 pectinesterase family protein contains ...    33   0.38 
At5g43870.1 68418.m05363 expressed protein                             32   0.67 
At4g00800.1 68417.m00110 expressed protein contains 1 WD-40 repe...    32   0.67 
At1g10720.1 68414.m01221 BSD domain-containing protein contains ...    32   0.67 
At1g12210.1 68414.m01413 disease resistance protein (CC-NBS-LRR ...    30   2.7  
At5g14420.4 68418.m01687 copine-related low similarity to SP|Q99...    29   4.7  
At5g14420.3 68418.m01686 copine-related low similarity to SP|Q99...    29   4.7  
At5g14420.2 68418.m01685 copine-related low similarity to SP|Q99...    29   4.7  
At5g14420.1 68418.m01684 copine-related low similarity to SP|Q99...    29   4.7  
At3g60380.1 68416.m06753 expressed protein                             29   4.7  
At5g20680.1 68418.m02456 expressed protein predicted proteins, A...    29   6.3  
At3g19860.1 68416.m02515 basic helix-loop-helix (bHLH) family pr...    28   8.3  
At2g30960.1 68415.m03776 expressed protein                             28   8.3  
At1g09770.1 68414.m01096 myb family transcription factor contain...    28   8.3  

>At2g28290.2 68415.m03434 chromatin remodeling protein, putative (SYD)
            similar to transcriptional activator HBRM [Homo sapiens]
            GI:414117; contains Pfam profiles PF00271: Helicase
            conserved C-terminal domain, PF00176: SNF2 family
            N-terminal domain; identical to cDNA putative chromatin
            remodeling protein SYD (SPLAYED) GI:13603720
          Length = 3529

 Score = 33.1 bits (72), Expect = 0.29
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 9/110 (8%)
 Frame = +2

Query: 599  SYLSAETPSDSLDS---NAE-ALQASATEDIL--TTLPTEPVVQTPPLQEPAINETTRRT 760
            S L+   PS SL +   N E  ++ +  E ++  T   TEP VQ PP  EP + E T   
Sbjct: 3035 SQLADTEPSSSLTAVQKNIEDQVETAGCEFVVVSTGCSTEPQVQLPPSAEPVVAEGT-EF 3093

Query: 761  PKDDLSNDIET---LLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQV 901
            P   L   ++    L+  + + +T L D+   S   T E +    + +QV
Sbjct: 3094 PSSLLMTGVDNSSHLMTGVDNAKTHLADVVPSSSPTTMEKNIEAQDQDQV 3143



 Score = 31.9 bits (69), Expect = 0.67
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = +2

Query: 596  SSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETT 751
            SS  + E   ++ D +          D+LT   +EP +Q PP  EP I+E T
Sbjct: 3126 SSPTTMEKNIEAQDQDQVTTGGCGLVDVLTECSSEPQLQLPPSAEPVISEGT 3177


>At2g28290.1 68415.m03433 chromatin remodeling protein, putative (SYD)
            similar to transcriptional activator HBRM [Homo sapiens]
            GI:414117; contains Pfam profiles PF00271: Helicase
            conserved C-terminal domain, PF00176: SNF2 family
            N-terminal domain; identical to cDNA putative chromatin
            remodeling protein SYD (SPLAYED) GI:13603720
          Length = 3574

 Score = 33.1 bits (72), Expect = 0.29
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 9/110 (8%)
 Frame = +2

Query: 599  SYLSAETPSDSLDS---NAE-ALQASATEDIL--TTLPTEPVVQTPPLQEPAINETTRRT 760
            S L+   PS SL +   N E  ++ +  E ++  T   TEP VQ PP  EP + E T   
Sbjct: 3035 SQLADTEPSSSLTAVQKNIEDQVETAGCEFVVVSTGCSTEPQVQLPPSAEPVVAEGT-EF 3093

Query: 761  PKDDLSNDIET---LLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQV 901
            P   L   ++    L+  + + +T L D+   S   T E +    + +QV
Sbjct: 3094 PSSLLMTGVDNSSHLMTGVDNAKTHLADVVPSSSPTTMEKNIEAQDQDQV 3143



 Score = 31.9 bits (69), Expect = 0.67
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = +2

Query: 596  SSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETT 751
            SS  + E   ++ D +          D+LT   +EP +Q PP  EP I+E T
Sbjct: 3126 SSPTTMEKNIEAQDQDQVTTGGCGLVDVLTECSSEPQLQLPPSAEPVISEGT 3177


>At4g33230.1 68417.m04730 pectinesterase family protein contains
           Pfam profile: PF01095 pectinesterase
          Length = 609

 Score = 32.7 bits (71), Expect = 0.38
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +2

Query: 587 KDHSSYLSAETPSDSLDSNA-EALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTP 763
           K   S   +E+PS    S+A + ++A   + I+ TL    + + P  Q    NET + TP
Sbjct: 63  KSKDSPTKSESPSPKPPSSAAQTVKAGQVDKIIQTLCNSTLYK-PTCQNTLKNETKKDTP 121

Query: 764 KDDLSNDIETLLVEIRD 814
           + D  + +++ +V + D
Sbjct: 122 QTDPRSLLKSAIVAVND 138


>At5g43870.1 68418.m05363 expressed protein 
          Length = 453

 Score = 31.9 bits (69), Expect = 0.67
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 584 WKDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQ 727
           W+ + ++   ETP DS++  +    ASATE     + + P  Q P ++
Sbjct: 13  WRSNPTFKPPETPLDSMEFLSRTWSASATEVSRAVVASPPTSQPPQMR 60


>At4g00800.1 68417.m00110 expressed protein contains 1 WD-40 repeat
           (PF00400); 42% similarity to fimbriae-associated protein
           Fap1 (gi:3929312) [Streptococcus parasanguinis]
          Length = 994

 Score = 31.9 bits (69), Expect = 0.67
 Identities = 18/71 (25%), Positives = 34/71 (47%)
 Frame = +2

Query: 590 DHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKD 769
           D  S+L +++ SDS D ++ ++     ++IL    +     +PP   P+IN   +  P  
Sbjct: 4   DLDSFLVSDSDSDS-DLDSSSVPHRTVDEILNASSSSSASSSPPSSPPSINRRKQDDPNR 62

Query: 770 DLSNDIETLLV 802
            LS  +  + V
Sbjct: 63  RLSEALTNVAV 73


>At1g10720.1 68414.m01221 BSD domain-containing protein contains
           Pfam profile PF03909: BSD domain
          Length = 429

 Score = 31.9 bits (69), Expect = 0.67
 Identities = 21/56 (37%), Positives = 27/56 (48%)
 Frame = +2

Query: 743 ETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRS 910
           E   R  KDDL+    TL  + R V   L  LPD S  ++ ++S     FNQ R S
Sbjct: 53  EAQARGVKDDLTELGHTLTRQFRGVANFLAPLPDGSSSSSSDLS-NHPRFNQSRSS 107


>At1g12210.1 68414.m01413 disease resistance protein (CC-NBS-LRR
           class), putative domain signature CC-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 885

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +2

Query: 248 VKQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDAECQY 385
           +  N PK + + L+ K+ VKV+   I+   K W+E+  + D   QY
Sbjct: 831 ILNNCPKLRKLPLDSKSVVKVEEFVIKYKEKKWIERVEWEDEATQY 876


>At5g14420.4 68418.m01687 copine-related low similarity to SP|Q99829
           Copine I {Homo sapiens}
          Length = 468

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +1

Query: 643 RGGSSSFRY*GYTNNPTYRTSCPNPTPTGASHQRDNP 753
           RGGSSS+     +  P+++ S P P PT   H R +P
Sbjct: 376 RGGSSSYNSPKPSRLPSFKPSVP-PHPTEGYHVRSSP 411


>At5g14420.3 68418.m01686 copine-related low similarity to SP|Q99829
           Copine I {Homo sapiens}
          Length = 468

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +1

Query: 643 RGGSSSFRY*GYTNNPTYRTSCPNPTPTGASHQRDNP 753
           RGGSSS+     +  P+++ S P P PT   H R +P
Sbjct: 376 RGGSSSYNSPKPSRLPSFKPSVP-PHPTEGYHVRSSP 411


>At5g14420.2 68418.m01685 copine-related low similarity to SP|Q99829
           Copine I {Homo sapiens}
          Length = 468

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +1

Query: 643 RGGSSSFRY*GYTNNPTYRTSCPNPTPTGASHQRDNP 753
           RGGSSS+     +  P+++ S P P PT   H R +P
Sbjct: 376 RGGSSSYNSPKPSRLPSFKPSVP-PHPTEGYHVRSSP 411


>At5g14420.1 68418.m01684 copine-related low similarity to SP|Q99829
           Copine I {Homo sapiens}
          Length = 468

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +1

Query: 643 RGGSSSFRY*GYTNNPTYRTSCPNPTPTGASHQRDNP 753
           RGGSSS+     +  P+++ S P P PT   H R +P
Sbjct: 376 RGGSSSYNSPKPSRLPSFKPSVP-PHPTEGYHVRSSP 411


>At3g60380.1 68416.m06753 expressed protein 
          Length = 743

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 6/59 (10%)
 Frame = +2

Query: 608 SAETPSDSLDSNAEAL-----QASATEDILTTLPTEPVVQ-TPPLQEPAINETTRRTPK 766
           S    ++SL+SN E L     + S++     +LP  P +  +PP  E   N+T RR+P+
Sbjct: 311 SRSVSAESLNSNVEELVKEKSRQSSSRSSSPSLPPSPSLSPSPPSPELVPNDTRRRSPE 369


>At5g20680.1 68418.m02456 expressed protein predicted proteins,
           Arabidopsis thaliana
          Length = 551

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = +2

Query: 53  EREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWINKY 181
           E   T+    S TL D  P+N+ DP T + ++L     ++ +Y
Sbjct: 337 ETNTTVLYHWSSTLCDIEPLNITDPATEHAMHLDRPPAFLRQY 379


>At3g19860.1 68416.m02515 basic helix-loop-helix (bHLH) family
           protein contains Pfam profile: PF00010 helix-loop-helix
           DNA-binding domain
          Length = 284

 Score = 28.3 bits (60), Expect = 8.3
 Identities = 19/79 (24%), Positives = 35/79 (44%)
 Frame = +2

Query: 632 LDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIR 811
           +D +A   Q +  E +      E  V+   + +P   +  + T   D    ++ L  E+ 
Sbjct: 1   MDVSARKSQKAGREKLRREKLNEHFVELGNVLDPERPKNDKATILTDTVQLLKELTSEVN 60

Query: 812 DVQTRLTDLPDESLEATEE 868
            +++  T L DES E T+E
Sbjct: 61  KLKSEYTALTDESRELTQE 79


>At2g30960.1 68415.m03776 expressed protein
          Length = 260

 Score = 28.3 bits (60), Expect = 8.3
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = -3

Query: 665 RKLEEPPRLNQANQKEFRRSSKSYD 591
           +K EE  R+N++N+K F R  +S D
Sbjct: 65  KKAEEEKRMNRSNRKHFGRKKESID 89


>At1g09770.1 68414.m01096 myb family transcription factor contains
           Pfam profile: PF00249 myb-like DNA-binding domain
          Length = 844

 Score = 28.3 bits (60), Expect = 8.3
 Identities = 28/107 (26%), Positives = 44/107 (41%), Gaps = 2/107 (1%)
 Frame = +2

Query: 617 TPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETL 796
           TPS  L+   + L A+ T+D       +P    P   +P       R    D+  D + +
Sbjct: 91  TPSQCLERYEKLLDAACTKDENYDAADDPRKLRPGEIDPNPEAKPARPDPVDMDEDEKEM 150

Query: 797 LVEIRD--VQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAE 931
           L E R     TR      ++ E   E +RR ++  Q RR  +A G +
Sbjct: 151 LSEARARLANTRGKKAKRKAREKQLEEARRLASL-QKRRELKAAGID 196


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,332,689
Number of Sequences: 28952
Number of extensions: 352197
Number of successful extensions: 1322
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 1239
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1319
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2392460208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).