SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0015
         (721 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g11860.3 68418.m01388 NLI interacting factor (NIF) family pro...   108   3e-24
At5g11860.2 68418.m01387 NLI interacting factor (NIF) family pro...   108   3e-24
At5g11860.1 68418.m01386 NLI interacting factor (NIF) family pro...   108   3e-24
At1g29780.1 68414.m03641 NLI interacting factor (NIF) family pro...    98   6e-21
At1g29770.1 68414.m03640 NLI interacting factor (NIF) family pro...    96   2e-20
At5g46410.1 68418.m05712 NLI interacting factor (NIF) family pro...    90   1e-18
At5g45700.1 68418.m05618 NLI interacting factor (NIF) family pro...    89   3e-18
At3g55960.1 68416.m06218 NLI interacting factor (NIF) family pro...    49   3e-06
At5g23470.1 68418.m02754 NLI interacting factor (NIF) family pro...    34   0.11 
At3g15330.1 68416.m01935 NLI interacting factor (NIF) family pro...    33   0.14 
At2g02290.1 68415.m00167 NLI interacting factor (NIF) family pro...    33   0.25 
At4g18140.1 68417.m02696 NLI interacting factor (NIF) family pro...    31   0.58 
At3g17550.1 68416.m02241 NLI interacting factor (NIF) family pro...    31   0.77 
At5g54210.1 68418.m06753 NLI interacting factor (NIF) family pro...    30   1.3  
At5g19090.1 68418.m02269 heavy-metal-associated domain-containin...    30   1.3  
At1g20320.1 68414.m02536 NLI interacting factor (NIF) family pro...    30   1.3  
At3g22380.1 68416.m02825 expressed protein                             30   1.8  
At5g58000.1 68418.m07256 phosphatase-related weak similarity to ...    29   2.3  
At2g33540.1 68415.m04111 CTD phosphatase-like protein 3 (CPL3) i...    29   2.3  
At1g57800.1 68414.m06558 zinc finger (C3HC4-type RING finger) fa...    29   4.1  
At1g43610.1 68414.m05006 NLI interacting factor (NIF) family pro...    29   4.1  
At1g43600.1 68414.m05005 NLI interacting factor (NIF) family pro...    29   4.1  
At3g19600.1 68416.m02485 NLI interacting factor (NIF) family pro...    28   5.4  
At3g46240.1 68416.m05005 protein kinase-related similar to light...    28   7.2  
At2g25730.1 68415.m03084 expressed protein                             27   9.5  

>At5g11860.3 68418.m01388 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 305

 Score =  108 bits (260), Expect = 3e-24
 Identities = 52/112 (46%), Positives = 74/112 (66%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+C    +V+DLDETLVHS+ +P     F  PV  +   H VYV  RPH+ EF+ R   
Sbjct: 106 TRSCPPISLVLDLDETLVHSTLEPCGEVDFTFPVNFNEEEHMVYVRCRPHLKEFMERVSR 165

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           L+  ++FTAS + YA+ + ++LD +  +FR R++RDSCVF  GNY+KDL+ L
Sbjct: 166 LFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVYRDSCVFFDGNYLKDLSVL 217


>At5g11860.2 68418.m01387 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 305

 Score =  108 bits (260), Expect = 3e-24
 Identities = 52/112 (46%), Positives = 74/112 (66%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+C    +V+DLDETLVHS+ +P     F  PV  +   H VYV  RPH+ EF+ R   
Sbjct: 106 TRSCPPISLVLDLDETLVHSTLEPCGEVDFTFPVNFNEEEHMVYVRCRPHLKEFMERVSR 165

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           L+  ++FTAS + YA+ + ++LD +  +FR R++RDSCVF  GNY+KDL+ L
Sbjct: 166 LFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVYRDSCVFFDGNYLKDLSVL 217


>At5g11860.1 68418.m01386 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 305

 Score =  108 bits (260), Expect = 3e-24
 Identities = 52/112 (46%), Positives = 74/112 (66%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+C    +V+DLDETLVHS+ +P     F  PV  +   H VYV  RPH+ EF+ R   
Sbjct: 106 TRSCPPISLVLDLDETLVHSTLEPCGEVDFTFPVNFNEEEHMVYVRCRPHLKEFMERVSR 165

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           L+  ++FTAS + YA+ + ++LD +  +FR R++RDSCVF  GNY+KDL+ L
Sbjct: 166 LFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVYRDSCVFFDGNYLKDLSVL 217


>At1g29780.1 68414.m03641 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 221

 Score = 97.9 bits (233), Expect = 6e-21
 Identities = 51/108 (47%), Positives = 70/108 (64%), Gaps = 1/108 (0%)
 Frame = +2

Query: 395 TCIKSVMVIDLDETLVHSSFKPINNAH-FVVPVEIDGAVHQVYVLKRPHVDEFLRRCGEL 571
           T +K  +++DLDETLVH++       H F+V V+++  +  ++V+KRP V EFL R GE 
Sbjct: 46  TNMKRTIILDLDETLVHATTHLPGVKHDFMVMVKMEREIMPIFVVKRPGVTEFLERLGEN 105

Query: 572 Y*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLN 715
           Y  V+FTA L +YA  V D LD+ GV   RL+RDSC    G YVKDL+
Sbjct: 106 YKVVVFTAGLEEYASQVLDKLDKNGVISQRLYRDSCTEVNGKYVKDLS 153


>At1g29770.1 68414.m03640 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 278

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 51/106 (48%), Positives = 68/106 (64%), Gaps = 2/106 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKP-IN-NAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY* 577
           K  + +DLDETLVHS+ +P I  N  F+V ++I+GAV  ++V+KRP V EFL R  + Y 
Sbjct: 102 KRTIFLDLDETLVHSTMEPPIRVNVDFMVRIKIEGAVIPMFVVKRPGVTEFLERISKNYR 161

Query: 578 CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLN 715
             +FTA L +YA  V D LD+  V   RL+RDSC    G Y KDL+
Sbjct: 162 VAIFTAGLPEYASQVLDKLDKNRVISQRLYRDSCTEVNGRYAKDLS 207


>At5g46410.1 68418.m05712 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 453

 Score = 90.2 bits (214), Expect = 1e-18
 Identities = 52/108 (48%), Positives = 67/108 (62%), Gaps = 2/108 (1%)
 Frame = +2

Query: 404 KSV-MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           KSV +V+DLDETLVHS+ +  N A F   V  +   + VYV +RPH+  FL R GEL+  
Sbjct: 279 KSVTLVLDLDETLVHSTLESCNVADFSFRVFFNMQENTVYVRQRPHLYRFLERVGELFHV 338

Query: 581 VLFTASLAKYADPVADLLDRWGVF-RARLFRDSCVFHRGNYVKDLNSL 721
           V+FTAS + YA  + D+LD  G F   R +RDSC+   G Y KDL  L
Sbjct: 339 VIFTASHSIYASQLLDILDPDGKFISQRFYRDSCILLDGIYTKDLTVL 386


>At5g45700.1 68418.m05618 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 272

 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 52/105 (49%), Positives = 64/105 (60%), Gaps = 2/105 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSF-KPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           K  +V+DLDETLVHSS  KP     FVV  +IDG +   +V+KRP VDEFL++ GE Y  
Sbjct: 97  KKTIVLDLDETLVHSSMEKPEVPYDFVVNPKIDGQILTFFVIKRPGVDEFLKKIGEKYQI 156

Query: 581 VLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDL 712
           V+FTA L +YA  V D LD    V     +RD+C    G  VKDL
Sbjct: 157 VVFTAGLREYASLVLDKLDPERRVISRSFYRDACSEIDGRLVKDL 201


>At3g55960.1 68416.m06218 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 305

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 32/79 (40%), Positives = 44/79 (55%), Gaps = 3/79 (3%)
 Frame = +2

Query: 491 EIDGA--VHQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARL 664
           E DG   ++ V V +RP + EFL +  E    +LFTA L  YA P+ D +D   V   RL
Sbjct: 143 EYDGKPKINYVTVFERPGLHEFLEQLSEFADLILFTAGLEGYARPLVDRIDTRKVLTNRL 202

Query: 665 FRDSCVFHR-GNYVKDLNS 718
           +R S V  +  ++VKDL S
Sbjct: 203 YRPSTVSTQYRDHVKDLLS 221


>At5g23470.1 68418.m02754 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 302

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 11/86 (12%)
 Frame = +2

Query: 413 MVIDLDETLVHS---SFKPINNAHFVVPVEI--------DGAVHQVYVLKRPHVDEFLRR 559
           +V+DLD+TL+H+   S    +  + +  VE          G   +  +  RP V +FL+ 
Sbjct: 89  LVLDLDQTLIHTIKTSLLYESEKYIIEEVESRKDIKRFNTGFPEESLIKLRPFVHQFLKE 148

Query: 560 CGELY*CVLFTASLAKYADPVADLLD 637
           C E++   ++T     YA  V +++D
Sbjct: 149 CNEMFSMYVYTKGGYDYARLVLEMID 174


>At3g15330.1 68416.m01935 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 305

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 8/83 (9%)
 Frame = +2

Query: 413 MVIDLDETLVHS-SFKPINNAH-FVVPVEIDGA------VHQVYVLKRPHVDEFLRRCGE 568
           +V+DLD TL+HS     ++ A  +++  E  G+       +   V  RP V+EFL+   +
Sbjct: 79  LVLDLDHTLIHSMKTSNLSKAEKYLIKEEKSGSRKDLRKYNNRLVKFRPFVEEFLKEANK 138

Query: 569 LY*CVLFTASLAKYADPVADLLD 637
           L+    +T   + Y   V  ++D
Sbjct: 139 LFTMTAYTKGGSTYGQAVVRMID 161


>At2g02290.1 68415.m00167 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 302

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 11/86 (12%)
 Frame = +2

Query: 413 MVIDLDETLVHS-SFKPINNAHFVVPVEID----------GAVHQVYVLKRPHVDEFLRR 559
           +V+DLD TLVH+     ++ +   +  E++          G   +  +  R  V +FL+ 
Sbjct: 89  LVLDLDHTLVHTIKVSQLSESEKYITEEVESRKDLRRFNTGFPEESLIKLRSFVHQFLKE 148

Query: 560 CGELY*CVLFTASLAKYADPVADLLD 637
           C E++   ++T     YA  V +++D
Sbjct: 149 CNEMFSLYVYTKGGYDYAQLVLEMID 174


>At4g18140.1 68417.m02696 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 312

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = +2

Query: 626 DLLDRWGVFRA-RLFRDSCVFHRGNYVKDLNSL 721
           D+LD  G F + R +RDSC+   G Y KDL  L
Sbjct: 208 DILDPDGKFVSQRFYRDSCILSDGIYTKDLTVL 240


>At3g17550.1 68416.m02241 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 296

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 9/84 (10%)
 Frame = +2

Query: 413 MVIDLDETLVHS-SFKPINNAHFVVPVEIDGAVHQV-------YVLK-RPHVDEFLRRCG 565
           +V+DLD TL+HS     ++     +  E      +        Y+ K RP V EFL+   
Sbjct: 88  LVLDLDHTLLHSIRVSLLSETEKCLIEEACSTTREDLWKLDSDYLTKLRPFVHEFLKEAN 147

Query: 566 ELY*CVLFTASLAKYADPVADLLD 637
           EL+   ++T     YA+ +  L+D
Sbjct: 148 ELFTMYVYTMGTRVYAESLLKLID 171


>At5g54210.1 68418.m06753 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 306

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 11/86 (12%)
 Frame = +2

Query: 413 MVIDLDETLVHSSF--KPINNAHFVVPVE--------IDGAVHQVYVLK-RPHVDEFLRR 559
           +V+DLD TL+H+           +++  E        ++G     +++K RP V EFL+ 
Sbjct: 91  LVLDLDHTLLHTVMISNLTKEETYLIEEEDSREDLRRLNGGYSSEFLIKLRPFVHEFLKE 150

Query: 560 CGELY*CVLFTASLAKYADPVADLLD 637
             +++   ++T     YA  V +L+D
Sbjct: 151 ANKMFSMYVYTMGDRDYAMNVLNLID 176


>At5g19090.1 68418.m02269 heavy-metal-associated domain-containing
           protein contains Pfam heavy-metal-associated domain
           PF00403; glycine-rich protein GRP22, rape, PIR:S31415;
           isoform contains a non-consensus TG-acceptor splice site
           at intron 3
          Length = 587

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +1

Query: 124 NYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           N GP+ G   G     G G P+SG  P G +   G GG
Sbjct: 377 NGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGG 414


>At1g20320.1 68414.m02536 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 342

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 7/82 (8%)
 Frame = +2

Query: 413 MVIDLDETLVHS-SFKPINNAHFVVPVEID------GAVHQVYVLKRPHVDEFLRRCGEL 571
           +V+DLD TL+HS     ++     +  E D          ++ +  RP V EFL+   E+
Sbjct: 79  LVLDLDHTLLHSIMISRLSEGEKYLLGESDFREDLWTLDREMLIKLRPFVHEFLKEANEI 138

Query: 572 Y*CVLFTASLAKYADPVADLLD 637
           +   ++T     YA  V   +D
Sbjct: 139 FSMYVYTMGNRDYAQAVLKWID 160


>At3g22380.1 68416.m02825 expressed protein
          Length = 1550

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 2/48 (4%)
 Frame = -2

Query: 366  SGGMF--RHDQQGRRSPAVDTIGAIASGRSLASATAPTAQQRSQEAAG 229
            SGG +  RH QQ   +PAV   GA+ +    A A A  +   + +  G
Sbjct: 1465 SGGYYIQRHQQQSGSAPAVPVTGAVTATSDPAKAIAAASAANNMKGGG 1512


>At5g58000.1 68418.m07256 phosphatase-related weak similarity to CTD
           phosphatase-like 3 [Arabidopsis thaliana] GI:22212705;
           contains Pfam profiles PF02453: Reticulon, PF00533:
           BRCA1 C Terminus (BRCT) domain, PF03031: NLI interacting
           factor
          Length = 1011

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 15/47 (31%), Positives = 23/47 (48%)
 Frame = +2

Query: 512 QVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVF 652
           Q+    RP V  FL+   E++   ++T     YA  +A LLD  G +
Sbjct: 745 QMMTKLRPFVHSFLKEASEMFVMYIYTMGDRNYARQMAKLLDPKGEY 791


>At2g33540.1 68415.m04111 CTD phosphatase-like protein 3 (CPL3)
            identical to CTD phosphatase-like 3 (CPL3) [Arabidopsis
            thaliana] GI:22212705; contains Pfam profile PF03031: NLI
            interacting factor
          Length = 1241

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +2

Query: 530  RPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGV-FRARL 664
            RP +  FL +  +LY   L+T     YA  +A LLD  GV F  R+
Sbjct: 983  RPGIWNFLEKASKLYELHLYTMGNKLYATEMAKLLDPKGVLFNGRV 1028


>At1g57800.1 68414.m06558 zinc finger (C3HC4-type RING finger)
           family protein contains zinc finger, C3HC4 type (RING
           finger), signature, PROSITE:PS00518
          Length = 660

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 13/49 (26%), Positives = 24/49 (48%)
 Frame = +1

Query: 31  LSPFVLRPKTNV*MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGD 177
           ++ FV  P+ N   + + +I ++ + +E+ N    D G   G  H E D
Sbjct: 588 IAEFVQNPQVN--REVAEVIEKLKKQEEEENAKSLDEGQCSGTSHEEED 634


>At1g43610.1 68414.m05006 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 255

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 10/85 (11%)
 Frame = +2

Query: 413 MVIDLDETLVHSSF-KPINNAHFVVPVEIDGAV---------HQVYVLKRPHVDEFLRRC 562
           +V+DLD TL+HS     ++     +  E D            ++  +  RP + EFL   
Sbjct: 55  LVLDLDHTLLHSVLVSDLSKREKYLLEETDSRQDLWRRNVDGYEFIIKLRPFLHEFLLEA 114

Query: 563 GELY*CVLFTASLAKYADPVADLLD 637
            +L+   ++T   + YA  V  L+D
Sbjct: 115 NKLFTMHVYTMGSSSYAKQVLKLID 139


>At1g43600.1 68414.m05005 NLI interacting factor (NIF) family
           protein contains Pfam profile PF03031: NLI interacting
           factor
          Length = 221

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 10/85 (11%)
 Frame = +2

Query: 413 MVIDLDETLVHSSF-KPINNAHFVVPVEIDGAV---------HQVYVLKRPHVDEFLRRC 562
           +V+DLD TL+HS     ++     +  E D            ++  +  RP + EFL   
Sbjct: 21  LVLDLDHTLLHSVLVSDLSKREKYLLEETDSRQDLWRRNVDGYEFIIKLRPFLHEFLLEA 80

Query: 563 GELY*CVLFTASLAKYADPVADLLD 637
            +L+   ++T   + YA  V  L+D
Sbjct: 81  NKLFTMHVYTMGSSSYAKQVLKLID 105


>At3g19600.1 68416.m02485 NLI interacting factor (NIF) family
           protein low similarity to CTD phosphatase [Xenopus
           laevis] GI:13487713; contains Pfam profile PF03031: NLI
           interacting factor
          Length = 601

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = +2

Query: 530 RPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLD 637
           RP + EFL+   E++   ++T     YA+ +  L+D
Sbjct: 148 RPFLCEFLKEANEMFTMYVYTKGTRPYAEAILKLID 183



 Score = 28.3 bits (60), Expect = 5.4
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 14/89 (15%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKP-INNAHFVVPVEIDGAVHQ-VYVLK------------RPHVDEF 550
           +V+DLD TL+H+   P ++ A   +  E   A    ++ +K            RP + +F
Sbjct: 388 LVLDLDHTLLHTVMVPSLSQAEKYLIEEAGSATRDDLWKIKAVGDPMEFLTKLRPFLRDF 447

Query: 551 LRRCGELY*CVLFTASLAKYADPVADLLD 637
           L+   E +   ++T     YA  V +L+D
Sbjct: 448 LKEANEFFTMYVYTKGSRVYAKQVLELID 476


>At3g46240.1 68416.m05005 protein kinase-related similar to light
           repressible receptor protein kinase (GI:1321686)
           [Arabidopsis thaliana]
          Length = 441

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 17/51 (33%), Positives = 23/51 (45%)
 Frame = +1

Query: 85  IITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           +I++ + +    N  G   GS  G     G G+  SGS   GG    GTGG
Sbjct: 297 VISKGTSESTGGNETGSGSGSGSGGSGGGGSGSSGSGSGS-GGTSKGGTGG 346


>At2g25730.1 68415.m03084 expressed protein 
          Length = 2464

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 14/27 (51%), Positives = 15/27 (55%)
 Frame = +1

Query: 148  SPGVQHNEGDGTPVSGSTPLGGKKSSG 228
            SPG  +   DG PVS  T   GKKS G
Sbjct: 981  SPGSANRAVDGNPVSHETEDKGKKSFG 1007


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,040,514
Number of Sequences: 28952
Number of extensions: 353035
Number of successful extensions: 1035
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 946
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1025
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1565336320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).