SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0013
         (823 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g43755.1 68418.m05351 expressed protein ; expression supporte...    30   1.6  
At5g58040.1 68418.m07263 fip1 motif-containing protein contains ...    30   2.1  
At4g39955.1 68417.m05659 hydrolase, alpha/beta fold family prote...    29   3.7  
At3g49790.1 68416.m05444 expressed protein predicted protein, Ar...    28   6.5  
At2g40260.1 68415.m04952 myb family transcription factor contain...    28   6.5  
At1g76880.1 68414.m08946 trihelix DNA-binding protein, putative ...    28   6.5  
At3g54630.1 68416.m06044 expressed protein weak similarity to re...    28   8.6  
At1g69740.1 68414.m08025 porphobilinogen synthase, putative / de...    28   8.6  
At1g63880.1 68414.m07234 disease resistance protein (TIR-NBS-LRR...    28   8.6  

>At5g43755.1 68418.m05351 expressed protein ; expression supported
           by MPSS
          Length = 176

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 1/68 (1%)
 Frame = +1

Query: 286 QNCWVNPQHGLLKHGCALVIASR-RGARARTYIRDSGGVMAARVSAEGAGPSYASVLNFK 462
           Q+ W  P  G +K        +R RG+ A   IRD  GV      A G      +VLN +
Sbjct: 47  QSQWQKPHMGWIKCNYDGSFVNRVRGSTAAWIIRDDNGVFKGAAQATGDCKLLVNVLNGR 106

Query: 463 GGESNKEN 486
           G   +  N
Sbjct: 107 GSRFDAIN 114


>At5g58040.1 68418.m07263 fip1 motif-containing protein contains
           Pfam profile PF05182: Fip1 motif
          Length = 1192

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 18/58 (31%), Positives = 28/58 (48%)
 Frame = +1

Query: 463 GGESNKENIEAHAEEALDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERKAPPRAHK 636
           GGES  E   + + +A     R D ++EE  +    H  RP  NR+  +  AP ++ K
Sbjct: 603 GGESKTER-SSESSKARSGSHR-DFQQEEDVIQD-KHSSRPANNRKQYDNNAPHQSRK 657


>At4g39955.1 68417.m05659 hydrolase, alpha/beta fold family protein
           low similarity to SP|P24640|LIP3_MORSP Lipase 3
           precursor (EC 3.1.1.3) (Triacylglycerol lipase)
           {Moraxella sp}; contains Pfam profile PF00561:
           hydrolase, alpha/beta fold family
          Length = 328

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 20/64 (31%), Positives = 33/64 (51%)
 Frame = +2

Query: 536 LKRRRASYRSSLMDGVLVKTGGTGNGKHPRELIKHHNSMLTLSPQRSNSNKLQNNSRRSL 715
           LKR     R+ L+  +L KTG   N + P+E+ KH  S L        ++++  N++R +
Sbjct: 260 LKRYLGEDRAQLV--LLKKTGHAINEEKPKEMYKHMKSFLCTDAMIPQNHQI--NAKRLM 315

Query: 716 LKRL 727
           L  L
Sbjct: 316 LANL 319


>At3g49790.1 68416.m05444 expressed protein predicted protein,
           Arabidopsis thaliana
          Length = 366

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = -3

Query: 260 FVRSARKPKSQTEHKSTGLRTNLIEIGSTPH*PWPDRI 147
           FVR++RKP       S    +  + +GST    W DR+
Sbjct: 242 FVRASRKPVQLNRSSSCQDSSQTLTVGSTKQATWIDRV 279


>At2g40260.1 68415.m04952 myb family transcription factor contains
           Pfam profile: PF00249 myb-like DNA-binding domain
          Length = 410

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +1

Query: 460 KGGESNKENIEAHAEEALDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERKAPPRAHKT 639
           K  E ++E  E   E + D  P  +  EEE         ++ G + R   R   PR   T
Sbjct: 29  KDEEDDEEGEEDEEERSGDQSPSSNSYEEESGSHHHDQNKKNGGSVRPYNRSKTPRLRWT 88

Query: 640 PQQH 651
           P+ H
Sbjct: 89  PELH 92


>At1g76880.1 68414.m08946 trihelix DNA-binding protein, putative
           similar to DNA-binding protein DF1 [Pisum sativum]
           GI:13646986
          Length = 603

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = +2

Query: 632 IKHHNSMLTLSPQRSNSNKLQNNSRRSL 715
           + HH     L PQ++N+N   NN+  S+
Sbjct: 154 LHHHQQQTPLRPQQNNNNNNNNNNNSSI 181


>At3g54630.1 68416.m06044 expressed protein weak similarity to
           retinoblastoma-associated protein HEC [Homo sapiens]
           GI:2501873
          Length = 568

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = +3

Query: 759 GSTGVPPPAPPALEQEK 809
           G  G PPP PP++EQ++
Sbjct: 14  GFGGAPPPPPPSIEQQR 30


>At1g69740.1 68414.m08025 porphobilinogen synthase, putative /
           delta-aminolevulinic acid dehydratase, putative similar
           to delta-aminolevulinic acid dehydratase (Alad)
           GI:493019 [SP|P43210] from Glycine max, SP|P24493 from
           Spinacia oleracea, SP|P30124 from Pisum sativum
          Length = 430

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 16/62 (25%), Positives = 24/62 (38%)
 Frame = +1

Query: 412 VSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAPPRPDIEEEEGFVPVISHGRRPGK 591
           V A  +G  +A  L     E        +  EA   PP+P        +  ++  RRP +
Sbjct: 51  VRASESGNGHAKKLGMSDAECEAAVAAGNVPEAPPVPPKPAAPVGTPIIKPLNLSRRPRR 110

Query: 592 NR 597
           NR
Sbjct: 111 NR 112


>At1g63880.1 68414.m07234 disease resistance protein (TIR-NBS-LRR
            class), putative domain signature TIR-NBS-LRR exists,
            suggestive of a disease resistance protein.
          Length = 1017

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +3

Query: 213  AFVFCL*FWLTR*THKTLNVSKFASKLLG*PPTWPVEAWMRARDRFTARS 362
            +FVFC+     + + KT+  S    +++     +PVE W R  D F  R+
Sbjct: 889  SFVFCVVVSRNQKSDKTIPPSLLWRRIIAQDEGYPVEVWNRIGDVFKYRT 938


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,082,875
Number of Sequences: 28952
Number of extensions: 353874
Number of successful extensions: 1280
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1171
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1272
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1882599200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).