SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0011
         (939 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g42530.1 68416.m04410 Ulp1 protease family similar to At5g281...    33   0.21 
At1g76280.1 68414.m08858 pentatricopeptide (PPR) repeat-containi...    30   1.9  
At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containi...    29   3.4  
At2g02580.1 68415.m00198 cytochrome P450 family protein                29   3.4  
At5g05240.1 68418.m00560 expressed protein similar to unknown pr...    29   4.4  
At5g48320.1 68418.m05969 DC1 domain-containing protein contains ...    29   5.9  
At5g08390.1 68418.m00988 transducin family protein / WD-40 repea...    28   7.8  
At5g07225.1 68418.m00824 zinc finger (C3HC4-type RING finger) fa...    28   7.8  
At4g16144.1 68417.m02448 expressed protein                             28   7.8  
At3g26320.1 68416.m03284 cytochrome P450 71B36, putative (CYP71B...    28   7.8  

>At3g42530.1 68416.m04410 Ulp1 protease family similar to At5g28170,
           At1g35110, At1g44880, At4g19320, At5g36020, At4g03970,
           At3g43010, At2g10350; contains Pfam profile PF02902:
           Ulp1 protease family, C-terminal catalytic domain
          Length = 889

 Score = 33.5 bits (73), Expect = 0.21
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +1

Query: 274 SDEPKVDTSKSKLSADAKEWYPANYTSQALPA-YNTEPAPYRPSRPSVQGRLRQAQDQNP 450
           S E  +   +  + ADA E  PA ++   LP  +N+E      +   V G+L+ + D+ P
Sbjct: 615 SVEKLLPLHQDHIIADASERVPATHSGLDLPKEHNSEELQTNANETDVYGKLQDSLDREP 674

Query: 451 YNLDDMSYSLEEA 489
            +  D+   +E++
Sbjct: 675 ASHSDIDLPIEQS 687


>At1g76280.1 68414.m08858 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 773

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 22/98 (22%), Positives = 49/98 (50%)
 Frame = +1

Query: 451 YNLDDMSYSLEEAENMDLRENIANLITVMCEITFDPGKFDTLCGPLVDSFASTLNDESYT 630
           ++ +D+ ++  +++N +L E +   + VM +    P  +D+    +    +  L  +   
Sbjct: 334 WSFNDVIHACGQSKNSELAEQLMLQLKVMQQQNLKP--YDSTLATVAAYCSKALQVD--- 388

Query: 631 RPLVDAIVNQSIGEANFRYNGARLCSMYDSVAQPEESV 744
             L + +++Q I E ++ Y    L + YDS+ QPE +V
Sbjct: 389 --LAEHLLDQ-ISECSYSYPFNNLLAAYDSLDQPERAV 423


>At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containing
           protein contains similarity to 67kD chloroplastic
           RNA-binding protein, P67.1 [Raphanus sativus]
           GI:9755886; contains Pfam profile PF01535: PPR repeat
          Length = 711

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 31/128 (24%), Positives = 55/128 (42%), Gaps = 7/128 (5%)
 Frame = +1

Query: 214 RGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEPA-- 387
           + R  ++N     L++PK + +EP + T    LS   K    A    Q      ++P   
Sbjct: 34  QSRSRKLNISCSSLKQPKTLEEEP-ITTKTPSLSEQLKP-LSATTLRQEQTQILSKPKSV 91

Query: 388 ---PYRPSRP--SVQGRLRQAQDQNPYNLDDMSYSLEEAENMDLRENIANLITVMCEITF 552
              P RP R   S+Q + R A   NP   D  +++L+   N  +    +  ++++ EI  
Sbjct: 92  WVNPTRPKRSVLSLQRQKRSAYSYNPQIKDLRAFALK--LNSSIFTEKSEFLSLLDEIPH 149

Query: 553 DPGKFDTL 576
            P + + L
Sbjct: 150 PPNRDNAL 157


>At2g02580.1 68415.m00198 cytochrome P450 family protein 
          Length = 500

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 15/29 (51%), Positives = 20/29 (68%)
 Frame = +2

Query: 803 WKLQRRICVDLLCSLPRLYSALRIVKEEE 889
           WK  RRICV  L S  R++S ++ +KEEE
Sbjct: 123 WKELRRICVQELFSAKRVHS-IQPIKEEE 150


>At5g05240.1 68418.m00560 expressed protein similar to unknown
           protein (gb AAD32815.2)
          Length = 530

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +1

Query: 172 IVKMNNGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVD 294
           ++  ++G I APK RGR  ++NN A   ++ K +  + +VD
Sbjct: 186 LISSSHGGIPAPKKRGRKTKINNDAAVAKKRK-IERKEEVD 225


>At5g48320.1 68418.m05969 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 977

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 2/74 (2%)
 Frame = -3

Query: 580 HTRCQTCPGQRLSHT*QLSSLLCSPVDP--CFQLLQVNKTCHPNCMDFDLELDEVYLVQR 407
           H RCQTC G+      +   ++   + P    QL+ +N      C   D +L+EV+    
Sbjct: 462 HIRCQTCNGENHGEYEKAPVVIKHTLHPKHSLQLVLLNGDTTRECYCCDKDLEEVF-YYC 520

Query: 406 GEMVYMGQVQCCKR 365
               Y   + C KR
Sbjct: 521 SACDYAMNIACIKR 534


>At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat
           family protein similar to katanin p80 subunit
           [Strongylocentrotus purpuratus] GI:3005601; contains
           Pfam profile PF00400: WD domain, G-beta repeat
          Length = 871

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 12/42 (28%), Positives = 21/42 (50%)
 Frame = +2

Query: 740 LYSASACSSAVPLRKTRLSAAWKLQRRICVDLLCSLPRLYSA 865
           + +   C+S +PL    L +       +C+DLL  L R+Y +
Sbjct: 775 ILTLDTCTSLLPLLTALLGSNMDSHLSVCLDLLLKLVRMYGS 816


>At5g07225.1 68418.m00824 zinc finger (C3HC4-type RING finger)
           family protein similar to SP:O54965 RING finger protein
           13 {Mus musculus} RING zinc finger protein
          Length = 234

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 3/67 (4%)
 Frame = +1

Query: 388 PYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAE--NMDLRENIA-NLITVMCEITFDP 558
           PY  S  S  G      + N ++LD++   +EE E  N  + E +    I+ +  I F P
Sbjct: 122 PYNDSPHSFSGYEHLEDESNQHSLDEIIERIEERERGNTSVGEGLTEGQISQLPTIKFKP 181

Query: 559 GKFDTLC 579
              D +C
Sbjct: 182 SLEDKMC 188


>At4g16144.1 68417.m02448 expressed protein
          Length = 390

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 20/61 (32%), Positives = 29/61 (47%)
 Frame = +1

Query: 229 QMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRP 408
           + N    +L R +  S +   D      S+DA EW PA+  S + P  N +P P   S+P
Sbjct: 95  EFNQLVDKLNRVEDESRQDGSDLPVVSYSSDAVEWPPAHKASYSRPDIN-KPLP--TSQP 151

Query: 409 S 411
           S
Sbjct: 152 S 152


>At3g26320.1 68416.m03284 cytochrome P450 71B36, putative (CYP71B36)
           identical to Cytochrome P450 71B36 (SP:Q9LIP4)
           [Arabidopsis thaliana]; contains Pfam profile: PF00067
           cytochrome P450
          Length = 500

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 19/45 (42%), Positives = 24/45 (53%)
 Frame = +2

Query: 803 WKLQRRICVDLLCSLPRLYSALRIVKEEE*DSR*SLCKFSASIGT 937
           WK  RRICV  L S+ R+ S  + +KE+E          SAS GT
Sbjct: 123 WKELRRICVQELFSVKRVQS-FQPIKEDEVKKLIDSVSESASQGT 166


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,237,709
Number of Sequences: 28952
Number of extensions: 479688
Number of successful extensions: 1419
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1343
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1418
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2246578488
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).