SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0009
         (585 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g03445.1 68414.m00325 kelch repeat-containing protein / serin...    29   2.3  
At5g19370.1 68418.m02308 rhodanese-like domain-containing protei...    29   3.0  
At1g34065.1 68414.m04223 mitochondrial substrate carrier family ...    29   3.0  
At3g16900.1 68416.m02161 hypothetical protein contains Pfam prof...    28   4.0  
At2g29200.1 68415.m03549 pumilio/Puf RNA-binding domain-containi...    28   4.0  
At2g29140.1 68415.m03542 pumilio/Puf RNA-binding domain-containi...    28   4.0  
At3g06290.1 68416.m00722 SAC3/GANP family protein contains Pfam ...    28   5.3  
At2g29190.1 68415.m03548 pumilio/Puf RNA-binding domain-containi...    28   5.3  
At1g73810.1 68414.m08546 expressed protein contains Pfam profile...    28   5.3  
At1g08700.1 68414.m00966 presenilin family protein similar to SP...    28   5.3  

>At1g03445.1 68414.m00325 kelch repeat-containing protein /
           serine/threonine phosphoesterase family protein contains
           Pfam profiles: PF00149 calcineurin-like phosphoesterase,
           PF01344: kelch motif
          Length = 795

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = +2

Query: 215 HIPTAAQLQPDVLDVCVHKGLRCPLTIEALYDLGTPHLP 331
           ++P AA L+  VL  CVH G+   +TIE + ++  P  P
Sbjct: 664 YLPLAALLEKKVL--CVHGGIGRAVTIEEIENIERPAFP 700


>At5g19370.1 68418.m02308 rhodanese-like domain-containing protein /
           PPIC-type PPIASE domain-containing protein low
           similarity to MPT-synthase sulfurylase [Synechococcus
           sp. PCC 7942] GI:2950364; contains Pfam profiles
           PF00581: Rhodanese-like domain, PF00639: PPIC-type
           PPIASE domain; identical to cDNA peptidyl-prolyl
           cis-trans isomerase GI:2246379
          Length = 299

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 1/61 (1%)
 Frame = -1

Query: 222 GMCVGSSGPTTE*SPLSASSN-SRLPTAEFSREPHATCFALRSPTSRAGRLSQFRTRLMS 46
           G    +S P    +  SA+   S  PT   +  PH   F+  S     GR+S  R R+ S
Sbjct: 6   GTLSAASSPAVAAASFSAALRLSITPTLAIASPPHLRWFSKFSRQFLGGRISSLRPRIPS 65

Query: 45  P 43
           P
Sbjct: 66  P 66


>At1g34065.1 68414.m04223 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 327

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 15/46 (32%), Positives = 22/46 (47%)
 Frame = +2

Query: 245 DVLDVCVHKGLRCPLTIEALYDLGTPHLPILVTLGMGLTRVATSPL 382
           D L  CV++ LR    + A  DL  P   ++      +T V T+PL
Sbjct: 208 DALQFCVYEQLRIGYKLAARRDLNDPENAMIGAFAGAVTGVLTTPL 253


>At3g16900.1 68416.m02161 hypothetical protein contains Pfam profile
           PF04525: Protein of unknown function (DUF567)
          Length = 185

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +3

Query: 354 GSPGLRPRPYDRRSTGSSLRDA*STFPQFRTPTPLRG 464
           GS  +RP+P D   TG +++DA +    F+  TPL G
Sbjct: 17  GSEFVRPQPLDLTITGDTVKDA-TGNKVFKVKTPLFG 52


>At2g29200.1 68415.m03549 pumilio/Puf RNA-binding domain-containing
           protein similar to BPM [Hordeum vulgare] GI:20513851
          Length = 968

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 18/52 (34%), Positives = 24/52 (46%)
 Frame = -3

Query: 280 P*PLMNAHIQHVGLELRGGRNVRGFVGADHRVVAPIGIF*QPPAHC*VQSGA 125
           P PLM+     V   L+G  NV G VG   +V     +F  PP     ++GA
Sbjct: 119 PPPLMSREDLRVAQRLKGSNNVLGGVGDRRKVNDNRSLFSMPPGFEGEKTGA 170


>At2g29140.1 68415.m03542 pumilio/Puf RNA-binding domain-containing
           protein 
          Length = 964

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 16/43 (37%), Positives = 20/43 (46%)
 Frame = -3

Query: 280 P*PLMNAHIQHVGLELRGGRNVRGFVGADHRVVAPIGIF*QPP 152
           P PLM+     V   L+G  NV G VG   +V     +F  PP
Sbjct: 120 PPPLMSREDLRVAQRLKGSNNVLGGVGDRRKVNDSRSLFSMPP 162


>At3g06290.1 68416.m00722 SAC3/GANP family protein contains Pfam
           profile: PF03399 SAC3/GANP family
          Length = 1720

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%)
 Frame = +1

Query: 25  GA*FSPRGHKTGPEL-RQPPSSAGRGPQ 105
           G  F P G ++GP + R PP SA + PQ
Sbjct: 65  GQSFGPGGIRSGPSIQRAPPLSASQNPQ 92


>At2g29190.1 68415.m03548 pumilio/Puf RNA-binding domain-containing
           protein 
          Length = 972

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 16/43 (37%), Positives = 20/43 (46%)
 Frame = -3

Query: 280 P*PLMNAHIQHVGLELRGGRNVRGFVGADHRVVAPIGIF*QPP 152
           P PLM+     V   L+G  NV G VG   +V     +F  PP
Sbjct: 119 PPPLMSREDLRVAQRLKGSSNVLGGVGDRRKVNDSQSLFSMPP 161


>At1g73810.1 68414.m08546 expressed protein contains Pfam profile
           PF03267: Arabidopsis protein of unknown function, DUF266
          Length = 418

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
 Frame = +3

Query: 327 SLSWSHWEWGSPGLRPRPYDRRS-TGSSLR 413
           SL+W+  +W   G  PR Y RRS TG  LR
Sbjct: 347 SLTWT--DWSRRGPHPRKYTRRSVTGEFLR 374


>At1g08700.1 68414.m00966 presenilin family protein similar to
           SP|P52166 Presenilin sel-12 {Caenorhabditis elegans};
           contains Pfam profile PF01080: Presenilin
          Length = 453

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 3/44 (6%)
 Frame = +2

Query: 257 VCVHKGLRCPLTIEALYDLGTPHLPILVTLGM---GLTRVATSP 379
           + +  GL C L + ++Y+   P LPI + LG+    LTR+   P
Sbjct: 398 LAIISGLGCTLILLSVYNRALPALPISIMLGVVFYFLTRLLMEP 441


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,466,830
Number of Sequences: 28952
Number of extensions: 331570
Number of successful extensions: 1019
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 979
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1019
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1151426952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).