SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0006
         (852 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g02390.1 68414.m00185 phospholipid/glycerol acyltransferase f...    30   2.2  
At4g01950.1 68417.m00260 phospholipid/glycerol acyltransferase f...    29   5.2  
At5g24230.1 68418.m02851 expressed protein                             28   6.9  
At1g14670.1 68414.m01744 endomembrane protein 70, putative simil...    28   6.9  
At5g46490.2 68418.m05725 disease resistance protein (TIR-NBS cla...    28   9.1  

>At1g02390.1 68414.m00185 phospholipid/glycerol acyltransferase
           family protein contains Pfam profile PF01553:
           Acyltransferase
          Length = 530

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = -2

Query: 821 IFFTYPSN*V*WITLFPDRTRDPLVRHDARLACRP 717
           I+F   S+   W TL  D+   PL+ HD RLA +P
Sbjct: 235 IYFVRNSDKKSWQTLPQDQYPKPLIFHDGRLAVKP 269


>At4g01950.1 68417.m00260 phospholipid/glycerol acyltransferase
           family protein contains Pfam profile PF01553:
           Acyltransferase
          Length = 520

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = -2

Query: 821 IFFTYPSN*V*WITLFPDRTRDPLVRHDARLACRPAL 711
           I+F   S+   W TL   +   PL+ HD RLA +P L
Sbjct: 229 IYFVKKSDKRSWQTLPRSQYPKPLIFHDGRLAIKPTL 265


>At5g24230.1 68418.m02851 expressed protein
          Length = 369

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 1/83 (1%)
 Frame = +1

Query: 367 Y*TSMFVSRVCRFIFSVGNNRYSNRI*KKKHQKQW-RIYTFCCLKTLYFERNTVTKMAIR 543
           Y  +   S + + ++++  +R  NRI  K     W   + F   +TL  + +     A+ 
Sbjct: 39  YHRTSVASCLVQAVYTLERDRQQNRIGLKSQANHWWEFFNFTLAETLIDDSDGSIYGAVF 98

Query: 544 DS*HTSSYSRTHCVDVKVQNRHV 612
           +  H  SY+  H    K   RHV
Sbjct: 99  EYKHFFSYNYHHTPHSKPPPRHV 121


>At1g14670.1 68414.m01744 endomembrane protein 70, putative similar
           to endomembrane protein emp70 precursor isolog
           GB:AAF67014 GI:7677068 (Homo sapiens)
          Length = 592

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = -1

Query: 471 PLFLVFFFLNTIAVSIVA 418
           PLFL F FLNT+A++  A
Sbjct: 372 PLFLTFCFLNTVAITYTA 389


>At5g46490.2 68418.m05725 disease resistance protein (TIR-NBS
           class), putative domain signature TIR-NBS exists,
           suggestive of a disease resistance protein.
          Length = 858

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 15/47 (31%), Positives = 21/47 (44%)
 Frame = -2

Query: 758 DPLVRHDARLACRPALHVNKISANTERLVAIKFYDLVLSNTKHLAFL 618
           DP   HD   AC     V  IS NT  +V +  ++  +    +L FL
Sbjct: 513 DPNDIHDVLNACTGTQKVLGISLNTRNIVELDVHESAIKGMSNLRFL 559


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,613,685
Number of Sequences: 28952
Number of extensions: 290292
Number of successful extensions: 502
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 496
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 502
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1980143200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).