SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0004
         (717 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496...   274   3e-74
At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S...   272   2e-73
At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A...   270   5e-73
At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A...   270   5e-73
At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A...   270   5e-73
At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A...   270   5e-73
At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A...   264   5e-71
At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497...   264   5e-71
At2g42100.1 68415.m05205 actin, putative very strong similarity ...   248   2e-66
At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara...   239   1e-63
At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A...   229   1e-60
At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac...   205   3e-53
At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id...   140   6e-34
At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica...   125   3e-29
At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i...   116   2e-26
At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i...   101   5e-22
At3g12380.1 68416.m01543 actin/actin-like family protein similar...    75   6e-14
At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) ...    70   1e-12
At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica...    68   5e-12
At5g43500.2 68418.m05318 expressed protein                             45   6e-05
At5g43500.1 68418.m05319 expressed protein                             45   6e-05
At3g14720.1 68416.m01861 mitogen-activated protein kinase, putat...    33   0.19 
At1g69270.1 68414.m07941 leucine-rich repeat family protein / pr...    30   1.3  
At5g46330.1 68418.m05703 leucine-rich repeat transmembrane prote...    30   1.8  
At4g00750.1 68417.m00102 dehydration-responsive family protein s...    29   4.1  
At2g39440.1 68415.m04841 expressed protein                             29   4.1  
At2g42760.1 68415.m05295 expressed protein                             28   5.4  
At1g53510.1 68414.m06068 mitogen-activated protein kinase, putat...    28   5.4  
At4g30340.1 68417.m04312 diacylglycerol kinase family protein co...    28   7.1  
At2g18730.1 68415.m02181 diacylglycerol kinase, putative contain...    27   9.4  
At1g05580.1 68414.m00578 cation/hydrogen exchanger, putative (CH...    27   9.4  

>At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496
           Actin 11 {Arabidopsis thaliana}
          Length = 377

 Score =  274 bits (673), Expect = 3e-74
 Identities = 125/140 (89%), Positives = 132/140 (94%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYELPDGQVITIG ERFRCPE LFQPS +GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 VEKSYELPDGQVITIGGERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+K EYDESGPSIVHRKCF
Sbjct: 358 WIAKAEYDESGPSIVHRKCF 377


>At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to
           SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana}
          Length = 377

 Score =  272 bits (666), Expect = 2e-73
 Identities = 124/140 (88%), Positives = 132/140 (94%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EK+YELPDGQVITIG ERFRCPE LFQPS +GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 VEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAPGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDESGPSIVHRKCF
Sbjct: 358 WISKSEYDESGPSIVHRKCF 377


>At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493
           Actin 3 {Arabidopsis thaliana}; supported by full-length
           cDNA: Ceres: 19581.
          Length = 377

 Score =  270 bits (663), Expect = 5e-73
 Identities = 122/140 (87%), Positives = 132/140 (94%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EK+YELPDGQVITIG+ERFRCPE L+QPS +GME  GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 VEKNYELPDGQVITIGSERFRCPEVLYQPSMIGMENAGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+K EYDESGPSIVHRKCF
Sbjct: 358 WIAKAEYDESGPSIVHRKCF 377


>At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 377

 Score =  270 bits (663), Expect = 5e-73
 Identities = 123/140 (87%), Positives = 131/140 (93%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EK+YELPDGQVITIG ERFRCPE LFQPSF+GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 IEKNYELPDGQVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+ GIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDE+GP IVHRKCF
Sbjct: 358 WISKAEYDEAGPGIVHRKCF 377


>At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671
           Actin 1 (Actin 3) {Arabidopsis thaliana}
          Length = 377

 Score =  270 bits (663), Expect = 5e-73
 Identities = 122/140 (87%), Positives = 132/140 (94%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EK+YELPDGQVITIG+ERFRCPE L+QPS +GME  GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 VEKNYELPDGQVITIGSERFRCPEVLYQPSMIGMENAGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+K EYDESGPSIVHRKCF
Sbjct: 358 WIAKAEYDESGPSIVHRKCF 377


>At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293
           Actin 8 {Arabidopsis thaliana}; nearly identical to
           SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and
           to At3g18780
          Length = 377

 Score =  270 bits (663), Expect = 5e-73
 Identities = 123/140 (87%), Positives = 131/140 (93%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EK+YELPDGQVITIG ERFRCPE LFQPSF+GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 IEKNYELPDGQVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+ GIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDE+GP IVHRKCF
Sbjct: 358 WISKAEYDEAGPGIVHRKCF 377


>At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494
           Actin 4 {Arabidopsis thaliana}
          Length = 377

 Score =  264 bits (646), Expect = 5e-71
 Identities = 121/140 (86%), Positives = 129/140 (92%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKS+ELPDGQVITIG ERFRCPE LFQPS +GME  GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 VEKSFELPDGQVITIGAERFRCPEVLFQPSMIGMENPGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+ GI DRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+K EYDESGPSIVHRKCF
Sbjct: 358 WIAKAEYDESGPSIVHRKCF 377


>At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497
           Actin 12 {Arabidopsis thaliana}
          Length = 377

 Score =  264 bits (646), Expect = 5e-71
 Identities = 121/140 (86%), Positives = 129/140 (92%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKS+ELPDGQVITIG ERFRCPE LFQPS +GME  GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 VEKSFELPDGQVITIGAERFRCPEVLFQPSMIGMENPGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+ GI DRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+K EYDESGPSIVHRKCF
Sbjct: 358 WIAKAEYDESGPSIVHRKCF 377


>At2g42100.1 68415.m05205 actin, putative very strong similarity to
           SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493
           Actin 3 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 378

 Score =  248 bits (608), Expect = 2e-66
 Identities = 111/140 (79%), Positives = 124/140 (88%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           ++++YELPDGQVITIG ERFRCPE LFQ S +GME  GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 239 IDRTYELPDGQVITIGAERFRCPEVLFQTSLIGMETSGIHETTYNSIMKCDVDIRKDLYG 298

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+PGIADRM KEI ALAP +MKIK++APPERKYSVW+GGSILASLS+F  M
Sbjct: 299 NIVLSGGTTMFPGIADRMNKEINALAPPSMKIKVVAPPERKYSVWVGGSILASLSSFAPM 358

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+K EYDE G +IVHRKCF
Sbjct: 359 WITKAEYDEQGGAIVHRKCF 378


>At2g42170.1 68415.m05219 actin, putative similar to actin 2
           [Arabidopsis thaliana] gi|9293903|dbj|BAB01806
          Length = 329

 Score =  239 bits (586), Expect = 1e-63
 Identities = 107/140 (76%), Positives = 123/140 (87%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           ++++YELPDGQVITIG ERFRCPE LFQPS +GME  GIHE TYNSIMKCD DIRKDLY 
Sbjct: 190 IDRTYELPDGQVITIGAERFRCPEVLFQPSLIGMETSGIHEKTYNSIMKCDDDIRKDLYG 249

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+ GI +RM KEI ALA + M+IKI+APPERKYSVWIGGSILASLST++QM
Sbjct: 250 NIVLSGGTTMFRGIEERMTKEINALAAANMRIKIVAPPERKYSVWIGGSILASLSTYEQM 309

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+K EY+E+GP+IVH KCF
Sbjct: 310 WITKAEYEENGPAIVHTKCF 329


>At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 371

 Score =  229 bits (560), Expect = 1e-60
 Identities = 106/124 (85%), Positives = 115/124 (92%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EK+YELPDGQVITIG ERFRCPE LFQPSF+GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 IEKNYELPDGQVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+ GIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQ+
Sbjct: 298 NIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQV 357

Query: 346 WISK 335
            I +
Sbjct: 358 KIDQ 361


>At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin
           11 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 366

 Score =  205 bits (500), Expect = 3e-53
 Identities = 91/142 (64%), Positives = 112/142 (78%)
 Frame = -3

Query: 715 GPPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           G  ++K+Y LPDGQ ITI  ERF CPE LFQPS +G E+ GIHE T NSI+KC VD R+D
Sbjct: 224 GWTIDKTYVLPDGQEITIEAERFMCPEVLFQPSVIGKESSGIHEATRNSILKCPVDTRRD 283

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 356
           +Y N +++GGTTM  GI +RM KE+ AL PS+MK+K++ PPE + SVWIGGSILASLSTF
Sbjct: 284 MYGNILMTGGTTMLHGIKERMTKELNALVPSSMKVKVVVPPESECSVWIGGSILASLSTF 343

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
            QMWI+K EY+E G +IVHRKC
Sbjct: 344 HQMWITKDEYEEHGAAIVHRKC 365


>At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary
           identical to actin-related protein 4 (ARP4) [Arabidopsis
           thaliana] GI:21427463; contains Pfam profile PF00022:
           Actin; supporting cDNA gi|21427462|gb|AF507912.1|
          Length = 441

 Score =  140 bits (340), Expect = 6e-34
 Identities = 69/151 (45%), Positives = 100/151 (66%), Gaps = 15/151 (9%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFL----GMEAC--------GIHETTYNSIMKCD 554
           SYELPDGQ + IG +RF+ P+ +F PS +    GME          G+      SI KCD
Sbjct: 290 SYELPDGQTLEIGADRFKVPDVMFNPSIVQTIPGMEKYAEMIPSVRGLPHMVMESINKCD 349

Query: 553 VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP---PERKYSVWIGG 383
           VDIR++LY++ +L+GGT+    + +R++K++   +P + ++K++A     ER++SVWIGG
Sbjct: 350 VDIRRELYSSILLAGGTSSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGG 409

Query: 382 SILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           SILASL +FQQMW SK EY+E G S + RKC
Sbjct: 410 SILASLGSFQQMWFSKSEYEEHGASYIQRKC 440


>At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical
           to actin-related protein 7 (ARP7) [Arabidopsis thaliana]
           GI:21427469; contains Pfam profile PF00022: Actin
          Length = 363

 Score =  125 bits (302), Expect = 3e-29
 Identities = 66/144 (45%), Positives = 85/144 (59%), Gaps = 6/144 (4%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           + + LPDGQVI+IG ER+   EALFQPS LG+E  GI E     I     +  + L  NT
Sbjct: 221 EQHTLPDGQVISIGRERYSVGEALFQPSILGLEEHGIVEQLVRIISTVSSENHRQLLENT 280

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE------RKYSVWIGGSILASLST 359
           VL GGTT   G   R QKE   L  S ++  ++ PPE        YS W+GG+ILA +  
Sbjct: 281 VLCGGTTSMTGFESRFQKEAN-LCSSAIRPTLVKPPEYMPENLGMYSAWVGGAILAKVVF 339

Query: 358 FQQMWISKQEYDESGPSIVHRKCF 287
            Q   ++K +YDE+GPS+VHRKCF
Sbjct: 340 PQNQHVTKADYDETGPSVVHRKCF 363


>At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly
           identical to actin-related protein 2 (ARP2) [Arabidopsis
           thaliana] GI:3818624; contains Pfam profile PF00022:
           Actin
          Length = 389

 Score =  116 bits (278), Expect = 2e-26
 Identities = 58/149 (38%), Positives = 94/149 (63%), Gaps = 12/149 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L K+Y LPDG+VI +G ERF+ PEALF P  + +E  G+ +  +  I + D+D R  LY 
Sbjct: 237 LVKNYTLPDGRVIKVGTERFQAPEALFTPELIDVEGDGMADMVFRCIQEMDIDNRMMLYQ 296

Query: 526 NTVLSGGTTMYPGIADRMQKEI------TALAPS-----TMKIKIIAPPERKYSVWIGGS 380
           + VLSGG+TMYPG+  R++KEI      T L  +      ++++I  PP RK+ V++GG+
Sbjct: 297 HIVLSGGSTMYPGLPSRLEKEIQDRYLDTVLKGNKDGLKKLRLRIEDPPRRKHMVYLGGA 356

Query: 379 ILAS-LSTFQQMWISKQEYDESGPSIVHR 296
           +LA  +    + WI++++Y E G + +++
Sbjct: 357 VLAGIMKDAPEFWINREDYMEEGINCLNK 385


>At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly
           identical to actin-related protein 6 (ARP6) [Arabidopsis
           thaliana] GI:21427467; contains Pfam profile PF00022:
           Actin
          Length = 421

 Score =  101 bits (242), Expect = 5e-22
 Identities = 48/128 (37%), Positives = 74/128 (57%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 491
           I + NERF  PE LFQP+ LGM   G+ E    +I  C   ++  LY + +L+GG+T++P
Sbjct: 293 IDLTNERFLVPETLFQPADLGMNQAGLAECIVRAINSCHSYLQPVLYQSIILTGGSTLFP 352

Query: 490 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 311
            + +R++ E+  L P    +KI    +    VW GGS+LAS   F+ M ++K EY+E G 
Sbjct: 353 QLKERLEGELRPLVPDHFDVKITTQEDPILGVWRGGSLLASSPDFESMCVTKAEYEELGS 412

Query: 310 SIVHRKCF 287
           +   R+ F
Sbjct: 413 ARCRRRFF 420


>At3g12380.1 68416.m01543 actin/actin-like family protein similar to
           SP|P53946 Actin-like protein ARP5 {Saccharomyces
           cerevisiae}; contains Pfam profile PF00022: Actin
          Length = 724

 Score = 74.5 bits (175), Expect = 6e-14
 Identities = 37/122 (30%), Positives = 65/122 (53%), Gaps = 3/122 (2%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC---DVDIRKDLYANTVLSGGTT 500
           I IG ERFRCPE LF P+ +G++  G+ E    SI +    + ++ + L ++ +++GG +
Sbjct: 589 IVIGIERFRCPEILFHPNLIGIDQVGLDEMAGTSIRRLPHDEKELEERLTSSILMTGGCS 648

Query: 499 MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 320
           + PG+ +R++  I  + P    I ++   +     W G S  A+   F     +K +YDE
Sbjct: 649 LLPGMNERLECGIRMIRPCGSPINVVRAMDPVLDAWRGASAFAANLNFLGNAFTKMDYDE 708

Query: 319 SG 314
            G
Sbjct: 709 KG 710


>At5g56180.1 68418.m07008 actin-related protein, putative (ARP8)
           strong similarity to actin-related protein 8A (ARP8)
           [Arabidopsis thaliana] GI:21427473; contains Pfam
           profile PF00022: Actin; supporting cDNA
           gi|21427470|gb|AF507916.1|
          Length = 471

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 39/132 (29%), Positives = 71/132 (53%), Gaps = 6/132 (4%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCD-VDIRKD--L 533
           + S E+      T+  ERF+  E LFQP   GM A  +H+     +  CD   +  D   
Sbjct: 332 QASVEVSGEGWFTLSKERFQTGEILFQPRLAGMRAMSLHQAVSLCMDHCDAAGLTGDDSW 391

Query: 532 YANTVLSGGTTMYPGIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSILASLST 359
           +   VL+GG+   PG+++R+++E+    PS++   I++I PP    + W G  ++++LS 
Sbjct: 392 FKTVVLTGGSACLPGLSERLERELQDHLPSSISNGIRVIPPPYGVDTSWHGAKLISNLSI 451

Query: 358 FQQMW-ISKQEY 326
           F   W I+++++
Sbjct: 452 FPGPWCITRKQF 463


>At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical
           to actin-related protein 3 (ARP3) [Arabidopsis thaliana]
           GI:21427461; contains Pfam profile PF00022: Actin
          Length = 427

 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 39/137 (28%), Positives = 67/137 (48%), Gaps = 17/137 (12%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPG 488
           +G ERF  PE  F P     +    +       I    +D R+ LY N VLSGG+TM+  
Sbjct: 280 VGYERFLGPEVFFNPEIYSNDFTTTLPAVIDKCIQSAPIDTRRALYKNIVLSGGSTMFKD 339

Query: 487 IADRMQKEITALAPS----------------TMKIKIIAPPERKYSVWIGGSILASLSTF 356
              R+Q+++  +  +                 +++ +++ P ++++VW GGS+L+S   F
Sbjct: 340 FGRRLQRDLKKIVDARVLANNARTGGEITSQPVEVNVVSHPVQRFAVWFGGSVLSSTPEF 399

Query: 355 QQMWISKQEYDESGPSI 305
                +K+EY+E G SI
Sbjct: 400 FASCRTKEEYEEYGASI 416


>At5g43500.2 68418.m05318 expressed protein
          Length = 584

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 25/102 (24%), Positives = 51/102 (50%), Gaps = 5/102 (4%)
 Frame = -3

Query: 604 EACGIHETTYNSIMKCD-VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK 428
           E  G+ E   +SI+    +D+R+ L+++  L GG  +  G+   +++ +    P T  I 
Sbjct: 458 EKIGLAEAITSSILSAGRIDLRRKLFSSIQLIGGAGLTKGLVAAVEERVLHAIPPTEAID 517

Query: 427 II----APPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
            +    +  E ++  W GG+IL  L   ++ WI + ++  +G
Sbjct: 518 TVQVLPSRTEPQFVTWKGGAILGILDFGREAWIERHQWMVNG 559


>At5g43500.1 68418.m05319 expressed protein
          Length = 596

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 25/102 (24%), Positives = 51/102 (50%), Gaps = 5/102 (4%)
 Frame = -3

Query: 604 EACGIHETTYNSIMKCD-VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK 428
           E  G+ E   +SI+    +D+R+ L+++  L GG  +  G+   +++ +    P T  I 
Sbjct: 470 EKIGLAEAITSSILSAGRIDLRRKLFSSIQLIGGAGLTKGLVAAVEERVLHAIPPTEAID 529

Query: 427 II----APPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
            +    +  E ++  W GG+IL  L   ++ WI + ++  +G
Sbjct: 530 TVQVLPSRTEPQFVTWKGGAILGILDFGREAWIERHQWMVNG 571


>At3g14720.1 68416.m01861 mitogen-activated protein kinase, putative
           / MAPK, putative (MPK19) identical to mitogen-activated
           protein kinase (MAPK)(AtMPK19), PMID:12119167;
          Length = 586

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 18/65 (27%), Positives = 33/65 (50%)
 Frame = -3

Query: 592 IHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP 413
           I E  Y  I++    + KD Y N+   G + +YP     ++K+   L  ++ K   + PP
Sbjct: 336 IRELIYREILEYHPQLLKD-YMNS--EGSSFLYPSAIGHLRKQFAYLEENSGKSGPVIPP 392

Query: 412 ERKYS 398
           +RK++
Sbjct: 393 DRKHA 397


>At1g69270.1 68414.m07941 leucine-rich repeat family protein /
           protein kinase family protein contains Pfam domains
           PF00560: Leucine Rich Repeat and PF00069: Protein kinase
           domain
          Length = 540

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
 Frame = +2

Query: 389 DPYGVLPLWRSNDLNLHCRW-GESCD 463
           DP GVL  W S+  + HC W G SC+
Sbjct: 45  DPNGVLSSWVSDSSSNHCSWYGVSCN 70


>At5g46330.1 68418.m05703 leucine-rich repeat transmembrane protein
           kinase, putative 
          Length = 1173

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%)
 Frame = +2

Query: 383 STDPYGVLPLWRSNDLNLHCRW-GESCDFLLHTVGDS 490
           S DP GVL  W       HC W G +CD   H V  S
Sbjct: 42  SNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVS 78


>At4g00750.1 68417.m00102 dehydration-responsive family protein
           similar to early-responsive to dehydration stress ERD3
           protein [Arabidopsis thaliana] GI:15320410; contains
           Pfam profile PF03141: Putative methyltransferase
          Length = 633

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 11/37 (29%), Positives = 22/37 (59%)
 Frame = -2

Query: 428 DHCSSREEVLRMDRWIDPRLPLYLPTDVDLETGVRRV 318
           D C   + +L MDR + P+  + +  D+D+ T V+++
Sbjct: 555 DRCDMEDILLEMDRILRPKGSVIIRDDIDVLTKVKKI 591


>At2g39440.1 68415.m04841 expressed protein
          Length = 773

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%)
 Frame = +2

Query: 338 RDP-HLLEGREGGEDRSTDPYGVLPLWRSNDLNLHCRWGESCD 463
           R+P     G E GEDR  DP   + + R NDL  +  +  + D
Sbjct: 39  REPGEFAAGMEEGEDRPIDPISDIDITRINDLMFNSNFRAAAD 81


>At2g42760.1 68415.m05295 expressed protein 
          Length = 267

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = -2

Query: 467 GNHSSRPIDNED*DHCSSREEVLRMDRWIDPRLPL-YLPTDVDLETGVRRVW 315
           GN ++RP  +E  DHC  R+   ++   I  R+P     ++VDL+  + R+W
Sbjct: 207 GNRAARPYLSEAWDHCGGRKGKKQITPEIKWRVPAPAAASEVDLKDNL-RLW 257


>At1g53510.1 68414.m06068 mitogen-activated protein kinase, putative
           / MAPK, putative (MPK18) mitogen-activated protein
           kinase (MAPK)(AtMPK18), PMID:12119167
          Length = 603

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 15/65 (23%), Positives = 31/65 (47%)
 Frame = -3

Query: 592 IHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP 413
           I E  Y  I++    + KD  + +   G   +YP     ++++ T L  ++ +   + P 
Sbjct: 336 IRELIYREILEYHPQLLKDYMSGS--EGSNFVYPSAIGHLRQQFTYLEENSSRNGPVIPL 393

Query: 412 ERKYS 398
           ERK++
Sbjct: 394 ERKHA 398


>At4g30340.1 68417.m04312 diacylglycerol kinase family protein
           contains INTERPRO domain, IPR001206, DAG-kinase
           catalytic domain
          Length = 374

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = +2

Query: 392 PYGVLPLWRSNDLNLHCRWGESCDF 466
           P GV+PL   NDL+    WG S  F
Sbjct: 192 PVGVIPLGTGNDLSRSFSWGGSFPF 216


>At2g18730.1 68415.m02181 diacylglycerol kinase, putative contains
           INTERPRO domain, IPR001206, DAG-kinase catalytic domain
          Length = 488

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = +2

Query: 392 PYGVLPLWRSNDLNLHCRWGESCDF 466
           P GV+PL   NDL+    WG S  F
Sbjct: 189 PVGVIPLGTGNDLSRSFGWGGSFPF 213


>At1g05580.1 68414.m00578 cation/hydrogen exchanger, putative
           (CHX23) monovalent cation:proton antiporter family 2
           (CPA2) member, PMID:11500563
          Length = 867

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 20/54 (37%), Positives = 27/54 (50%)
 Frame = +3

Query: 405 FLSGGAMILIFIVDGARAVISFCIRSAIPGYMVVPPDNTVLAYKSLRMSTSHFM 566
           FLSG  M L +I+ G RA I F ++      MVV   ++ L      + TS FM
Sbjct: 333 FLSGILMPLFYIICGLRADIGFMLQFTDKFMMVVVICSSFLVKIVTTVITSLFM 386


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,855,213
Number of Sequences: 28952
Number of extensions: 342880
Number of successful extensions: 1051
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 998
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1040
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1555552968
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).