SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0003
         (841 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g03435.1 68418.m00297 C2 domain-containing protein contains P...    30   1.7  
At3g45290.1 68416.m04890 seven transmembrane MLO family protein ...    30   1.7  
At3g18620.1 68416.m02366 zinc finger (DHHC type) family protein ...    29   5.1  
At2g01740.1 68415.m00103 pentatricopeptide (PPR) repeat-containi...    28   8.9  

>At5g03435.1 68418.m00297 C2 domain-containing protein contains Pfam
           profile PF00168: C2 domain
          Length = 745

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 8/25 (32%), Positives = 17/25 (68%)
 Frame = -1

Query: 280 LCIVKAINWFLLCLFYWQGYPIIWW 206
           +C++ A+ W+ + ++ W  YPI +W
Sbjct: 693 ICVLVALCWYNIPMWLWSLYPIAYW 717


>At3g45290.1 68416.m04890 seven transmembrane MLO family protein /
           MLO-like protein 3 (MLO3) membrane protein Mlo3
           [Arabidopsis thaliana] gi|14091576|gb|AAK53796; similar
           to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221
           [Hordeum vulgare][Barley]
          Length = 508

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +2

Query: 404 ISHYLLFLNSY*LEFISKIILKYQMKISLCYLQRTYVYVLRL 529
           I HY LFLN++ + FI  + + +Q  I+ CY     + + RL
Sbjct: 362 ILHYTLFLNTFEMAFI--VWITWQFGINSCYHDNQGIIITRL 401


>At3g18620.1 68416.m02366 zinc finger (DHHC type) family protein
           contains Pfam profile: PF01529 DHHC zinc finger domain
          Length = 345

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 11/38 (28%), Positives = 20/38 (52%)
 Frame = -1

Query: 322 TKTINLSYTRKQCGLCIVKAINWFLLCLFYWQGYPIIW 209
           TK+  L   R +C + I+     F++C   W  YP+++
Sbjct: 55  TKSFGLRRFRDRCFVVILAVFMLFVICGGIWAAYPVLF 92


>At2g01740.1 68415.m00103 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 559

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 17/46 (36%), Positives = 25/46 (54%)
 Frame = -3

Query: 239 ILLARLSYHMVVYMILLVTVLVELGKEFDAQPNLNISPLSFSPDLL 102
           +LL  L+Y  ++Y +    ++VE  + FD   N  ISP S   DLL
Sbjct: 469 LLLDLLAYTTLIYGLASKGLMVEARQVFDEMLNSGISPDSAVFDLL 514


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,981,985
Number of Sequences: 28952
Number of extensions: 201515
Number of successful extensions: 388
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 382
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 388
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1941125600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).