SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0001
         (944 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g09510.1 68418.m01100 40S ribosomal protein S15 (RPS15D) ribo...   107   8e-24
At1g04270.1 68414.m00418 40S ribosomal protein S15 (RPS15A) Stro...   107   8e-24
At5g09490.1 68418.m01098 40S ribosomal protein S15 (RPS15B) ribo...   106   2e-23
At5g43640.1 68418.m05334 40S ribosomal protein S15 (RPS15E)           103   2e-22
At5g09500.1 68418.m01099 40S ribosomal protein S15 (RPS15C) ribo...   103   2e-22
At5g63070.1 68418.m07914 40S ribosomal protein S15, putative           93   3e-19
At1g33850.1 68414.m04194 40S ribosomal protein S15, putative sim...    41   0.001
At3g22380.1 68416.m02825 expressed protein                             29   4.5  
At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria...    28   7.8  

>At5g09510.1 68418.m01100 40S ribosomal protein S15 (RPS15D)
           ribosomal protein S15 - Arabidopsis thaliana,
           EMBL:Z23161
          Length = 152

 Score =  107 bits (258), Expect = 8e-24
 Identities = 49/76 (64%), Positives = 60/76 (78%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEM 634
           ++ L++L           GL RKPMAL+KKLR+AK+EAP  EKPE V+THLRNMIIVPEM
Sbjct: 37  TDDLVKLFSSRIRRRFSRGLTRKPMALIKKLRKAKREAPAGEKPEPVRTHLRNMIIVPEM 96

Query: 635 VGSIVGIYNGKTFNQV 682
           +GSI+G+YNGKTFNQV
Sbjct: 97  IGSIIGVYNGKTFNQV 112



 Score = 37.1 bits (82), Expect = 0.017
 Identities = 15/21 (71%), Positives = 18/21 (85%)
 Frame = +3

Query: 177 KKRIFRKFTYRGVDLDQLLDM 239
           KKR F+KF ++GVDLD LLDM
Sbjct: 15  KKRTFKKFAFKGVDLDALLDM 35


>At1g04270.1 68414.m00418 40S ribosomal protein S15 (RPS15A) Strong
           similarity to Oryza 40S ribosomal protein S15. ESTs
           gb|R29788,gb|ATTS0365 come from this gene
          Length = 152

 Score =  107 bits (258), Expect = 8e-24
 Identities = 49/76 (64%), Positives = 60/76 (78%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEM 634
           ++ L++L           GL RKPMAL+KKLR+AK+EAP  EKPE V+THLRNMIIVPEM
Sbjct: 37  TDDLVKLFSSRIRRRFSRGLTRKPMALIKKLRKAKREAPQGEKPEPVRTHLRNMIIVPEM 96

Query: 635 VGSIVGIYNGKTFNQV 682
           +GSI+G+YNGKTFNQV
Sbjct: 97  IGSIIGVYNGKTFNQV 112



 Score = 37.1 bits (82), Expect = 0.017
 Identities = 15/21 (71%), Positives = 18/21 (85%)
 Frame = +3

Query: 177 KKRIFRKFTYRGVDLDQLLDM 239
           KKR F+KF ++GVDLD LLDM
Sbjct: 15  KKRTFKKFAFKGVDLDALLDM 35


>At5g09490.1 68418.m01098 40S ribosomal protein S15 (RPS15B)
           ribosomal protein S15 - Arabidopsis thaliana,
           EMBL:Z23161
          Length = 152

 Score =  106 bits (255), Expect = 2e-23
 Identities = 46/76 (60%), Positives = 60/76 (78%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEM 634
           ++ L+EL           GL RKPMAL+KKLR+AK +AP  EKPE+V+THLRNM+I+PEM
Sbjct: 37  TDDLVELFPSRIRRRMSRGLTRKPMALIKKLRKAKLDAPAGEKPEVVRTHLRNMVIMPEM 96

Query: 635 VGSIVGIYNGKTFNQV 682
           +GSI+G+YNGKTFNQ+
Sbjct: 97  IGSIIGVYNGKTFNQI 112



 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 17/24 (70%), Positives = 21/24 (87%)
 Frame = +3

Query: 171 LKKKRIFRKFTYRGVDLDQLLDMP 242
           L KKR F+KF+++GVDLD LLDMP
Sbjct: 13  LAKKRTFKKFSFKGVDLDALLDMP 36


>At5g43640.1 68418.m05334 40S ribosomal protein S15 (RPS15E) 
          Length = 149

 Score =  103 bits (247), Expect = 2e-22
 Identities = 46/58 (79%), Positives = 52/58 (89%)
 Frame = +2

Query: 509 GLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQV 682
           GL RKPMAL+KKLR+AK EAP  EKP  V+THLRNMIIVPEM+GSI+G+YNGKTFNQV
Sbjct: 52  GLTRKPMALIKKLRKAKMEAPAGEKPASVRTHLRNMIIVPEMIGSIIGVYNGKTFNQV 109



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 16/21 (76%), Positives = 19/21 (90%)
 Frame = +3

Query: 177 KKRIFRKFTYRGVDLDQLLDM 239
           KKR F+KF++RGVDLD LLDM
Sbjct: 12  KKRTFKKFSFRGVDLDALLDM 32


>At5g09500.1 68418.m01099 40S ribosomal protein S15 (RPS15C)
           ribosomal protein S15 - Arabidopsis thaliana,
           EMBL:Z23161
          Length = 150

 Score =  103 bits (247), Expect = 2e-22
 Identities = 47/76 (61%), Positives = 58/76 (76%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEM 634
           ++ L++L           GL RKPMAL+KKLR+AK EAP  EKP  V+THLRNMIIVPEM
Sbjct: 35  TDDLVKLFPSRIRRRFSRGLTRKPMALIKKLRKAKIEAPAGEKPAAVRTHLRNMIIVPEM 94

Query: 635 VGSIVGIYNGKTFNQV 682
           +GS++G+YNGKTFNQV
Sbjct: 95  IGSVIGVYNGKTFNQV 110



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 16/21 (76%), Positives = 19/21 (90%)
 Frame = +3

Query: 177 KKRIFRKFTYRGVDLDQLLDM 239
           KKR F+KF++RGVDLD LLDM
Sbjct: 13  KKRTFKKFSFRGVDLDALLDM 33


>At5g63070.1 68418.m07914 40S ribosomal protein S15, putative
          Length = 160

 Score = 92.7 bits (220), Expect = 3e-19
 Identities = 41/60 (68%), Positives = 52/60 (86%), Gaps = 2/60 (3%)
 Frame = +2

Query: 509 GLKRKPMALVKKLRRAKKEAPPNEK--PEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQV 682
           GLK++P+ L+KKLRRAKKEA    K  PE+VKTHLRNMIIVPEM+GS+VG++NGK FN++
Sbjct: 57  GLKKQPLILIKKLRRAKKEASDENKMKPEVVKTHLRNMIIVPEMIGSVVGVHNGKKFNEI 116



 Score = 30.7 bits (66), Expect = 1.5
 Identities = 12/21 (57%), Positives = 17/21 (80%)
 Frame = +3

Query: 177 KKRIFRKFTYRGVDLDQLLDM 239
           KKR F+KF++RG ++D LL M
Sbjct: 17  KKRTFKKFSFRGFNVDALLKM 37


>At1g33850.1 68414.m04194 40S ribosomal protein S15, putative
           similar to SP|Q08112 40S ribosomal protein S15
           {Arabidopsis thaliana}
          Length = 70

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/21 (80%), Positives = 20/21 (95%)
 Frame = +3

Query: 177 KKRIFRKFTYRGVDLDQLLDM 239
           KKRIF+KF++RGVDLD LLDM
Sbjct: 12  KKRIFKKFSFRGVDLDALLDM 32



 Score = 30.7 bits (66), Expect = 1.5
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +2

Query: 509 GLKRKPMALVKKLRRAKK 562
           G  RKPMAL+KKLR+A K
Sbjct: 52  GFTRKPMALIKKLRKAVK 69


>At3g22380.1 68416.m02825 expressed protein
          Length = 1550

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%)
 Frame = +1

Query: 541 EAASRQERGSSE*EARDREDSLEKHDHRSRD---GRFNCRHLQRK 666
           EAA  ++RG S  + RDRE   ++   R RD    R N R  +R+
Sbjct: 43  EAARLRDRGGSNKKDRDRERDRDRERERERDRERDRLNSRSKRRR 87


>At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial
           (RPS19)
          Length = 212

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +2

Query: 608 RNMIIVPEMVGSIVGIYNGKT 670
           R   I+PE V S V IYNGKT
Sbjct: 161 RRSTILPEYVDSAVRIYNGKT 181


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,722,620
Number of Sequences: 28952
Number of extensions: 325176
Number of successful extensions: 695
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 667
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 694
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2266029384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).