SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0044
         (613 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g16080.1 68418.m01879 expressed protein similar to PrMC3 [Pin...    29   2.4  
At3g21000.1 68416.m02655 expressed protein ; expression supporte...    27   9.8  

>At5g16080.1 68418.m01879 expressed protein similar to PrMC3 [Pinus
           radiata] GI:5487873
          Length = 344

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
 Frame = +1

Query: 232 KLFCTVIFNNKHPVFEIQRGIFLSFVRHGVKRPNGVVEPGLT-AIRVLIVAGRTRDRIHD 408
           KL  T++F  +  + + +       +R   KR  G+V  G+  A  +L  +  +RDRIHD
Sbjct: 273 KLPTTMVFMAEFDILKERNLEMCKVMRSHGKRVEGIVHGGVGHAFHILDNSSVSRDRIHD 332

Query: 409 QQLR 420
              R
Sbjct: 333 MMCR 336


>At3g21000.1 68416.m02655 expressed protein ; expression supported
           by MPSS
          Length = 405

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 10/31 (32%), Positives = 19/31 (61%)
 Frame = -2

Query: 312 TDEREKNTTLYLKYRVFIIENNGAKQFNNSV 220
           TD+ EK   + + YR+  + N GAK +++ +
Sbjct: 249 TDKEEKEDEIVVDYRLETVPNLGAKTYDDDI 279


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,756,710
Number of Sequences: 28952
Number of extensions: 218145
Number of successful extensions: 430
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 426
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 430
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1226538000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).