SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0042
         (619 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g22680.1 68415.m02688 zinc finger (C3HC4-type RING finger) fa...    29   1.9  
At1g59453.1 68414.m06679 transcription factor-related weak simil...    27   7.5  
At5g43090.1 68418.m05260 pumilio/Puf RNA-binding domain-containi...    27   10.0 
At3g60680.1 68416.m06789 expressed protein contains Pfam profile...    27   10.0 
At3g24880.1 68416.m03120 expressed protein                             27   10.0 

>At2g22680.1 68415.m02688 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profiles PF00097: Zinc
           finger, C3HC4 type (RING finger), PF00092: von
           Willebrand factor type A domain
          Length = 683

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 19/54 (35%), Positives = 26/54 (48%)
 Frame = -2

Query: 372 ISSRLWERRIRTILRMNRISKRSMRLKHTLTNNRRPCRRLVTEIDIITSVRRVG 211
           + S L E    +I+  +  SKR   L+    N RR  RR+V  I +  SV  VG
Sbjct: 328 VLSNLREMDRLSIIAFSSSSKRLSPLRRMTANGRRSARRIVDIITVPGSVSGVG 381


>At1g59453.1 68414.m06679 transcription factor-related weak similarity
            to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362
          Length = 1729

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = -2

Query: 354  ERRIRTILRMNRISKRSMRLKHTLTNNRRPCRRLVTEIDII 232
            +RRI+T++R +++ K  MRL + L  + R  + L TE D +
Sbjct: 1059 KRRIQTMMRNDKVRKAVMRLCNLL--SERYAKHLKTESDSV 1097


>At5g43090.1 68418.m05260 pumilio/Puf RNA-binding domain-containing
           protein contains similarity to RNA-binding protein
          Length = 527

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 14/46 (30%), Positives = 27/46 (58%)
 Frame = +2

Query: 227 EVIMSISVTRRLHGLLLFVNVCFSLIDLLEIRFILSIVRIRLSQSL 364
           ++I+ + V  R H +  FVN+CF+ I  L I+ +L+ +  R +  +
Sbjct: 273 QIILIVDVVTR-H-ISKFVNICFNPIGTLAIQVLLTSIHERANNQI 316


>At3g60680.1 68416.m06789 expressed protein contains Pfam profile
           PF04859: Plant protein of unknown function (DUF641
          Length = 499

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
 Frame = -1

Query: 310 EIYETKTYINKQ*KAMQAPSNRNRHNYFS-APRRAPVTYTTVKGPMQFFSCIICEVFLT 137
           EI++ ++ +      M+    R +   FS +P RA V +T V G     + I C+V+LT
Sbjct: 436 EIFQVESGVEFSIVFMENVLKRKQDKKFSMSPTRAKVGFTVVPGFKIGCTVIQCQVYLT 494


>At3g24880.1 68416.m03120 expressed protein
          Length = 1957

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 10/34 (29%), Positives = 20/34 (58%)
 Frame = +2

Query: 170  KLHWPFDCRVGHRCPTRRTEVIMSISVTRRLHGL 271
            K H+   C +G +   R+T+ ++ +SV   +HG+
Sbjct: 1152 KSHFEKICLIGKKLHYRKTQSVIGVSVVSFVHGI 1185


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,487,725
Number of Sequences: 28952
Number of extensions: 247660
Number of successful extensions: 396
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 390
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 396
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1246162608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).