SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0039
         (616 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496...   188   3e-48
At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A...   187   4e-48
At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497...   187   4e-48
At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S...   186   1e-47
At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A...   185   2e-47
At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A...   185   2e-47
At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A...   184   3e-47
At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A...   184   3e-47
At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A...   184   3e-47
At2g42100.1 68415.m05205 actin, putative very strong similarity ...   166   1e-41
At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara...   160   8e-40
At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac...   154   4e-38
At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i...   105   3e-23
At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica...    93   1e-19
At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id...    83   1e-16
At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identica...    66   2e-11
At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica...    57   8e-09
At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i...    55   4e-08
At3g12380.1 68416.m01543 actin/actin-like family protein similar...    47   9e-06
At5g01040.1 68418.m00007 laccase family protein / diphenol oxida...    34   0.086
At1g16690.2 68414.m01999 transcription factor-related similar to...    31   0.80 
At1g16690.1 68414.m01998 transcription factor-related similar to...    31   0.80 
At1g31850.3 68414.m03915 dehydration-responsive protein, putativ...    29   2.4  
At1g31850.2 68414.m03914 dehydration-responsive protein, putativ...    29   2.4  
At1g31850.1 68414.m03913 dehydration-responsive protein, putativ...    29   2.4  
At5g17420.1 68418.m02044 cellulose synthase, catalytic subunit (...    29   3.2  
At3g19480.1 68416.m02469 D-3-phosphoglycerate dehydrogenase, put...    28   4.3  
At5g64580.1 68418.m08116 AAA-type ATPase family protein similar ...    28   5.7  
At2g41830.1 68415.m05169 cyclin-related contains Pfam profile PF...    28   5.7  
At1g28320.1 68414.m03475 protease-related similar to Protease de...    28   5.7  
At5g06610.1 68418.m00747 expressed protein contains Pfam profile...    27   7.5  
At1g02110.1 68414.m00137 proline-rich family protein contains pr...    27   7.5  
At4g32410.1 68417.m04614 cellulose synthase, catalytic subunit, ...    27   9.9  
At3g12970.1 68416.m01616 expressed protein                             27   9.9  
At2g43180.4 68415.m05365 expressed protein                             27   9.9  
At2g43180.3 68415.m05363 expressed protein                             27   9.9  
At2g43180.2 68415.m05364 expressed protein                             27   9.9  
At2g43180.1 68415.m05362 expressed protein                             27   9.9  
At2g31900.1 68415.m03897 myosin family protein contains Pfam pro...    27   9.9  
At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t...    27   9.9  
At1g55420.1 68414.m06339 DC1 domain-containing protein contains ...    27   9.9  
At1g17540.1 68414.m02157 protein kinase-related similar to serin...    27   9.9  

>At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496
           Actin 11 {Arabidopsis thaliana}
          Length = 377

 Score =  188 bits (457), Expect = 3e-48
 Identities = 92/119 (77%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 2e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494
           Actin 4 {Arabidopsis thaliana}
          Length = 377

 Score =  187 bits (456), Expect = 4e-48
 Identities = 92/119 (77%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 2e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497
           Actin 12 {Arabidopsis thaliana}
          Length = 377

 Score =  187 bits (456), Expect = 4e-48
 Identities = 92/119 (77%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 2e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to
           SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana}
          Length = 377

 Score =  186 bits (452), Expect = 1e-47
 Identities = 91/119 (76%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 2e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493
           Actin 3 {Arabidopsis thaliana}; supported by full-length
           cDNA: Ceres: 19581.
          Length = 377

 Score =  185 bits (450), Expect = 2e-47
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 2e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671
           Actin 1 (Actin 3) {Arabidopsis thaliana}
          Length = 377

 Score =  185 bits (450), Expect = 2e-47
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 2e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 377

 Score =  184 bits (449), Expect = 3e-47
 Identities = 90/118 (76%), Positives = 96/118 (81%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VGDEAQSKRGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPK
Sbjct: 56  VGDEAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPK 115

Query: 435 ANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKGF 608
           ANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI  +GF
Sbjct: 116 ANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPIY-EGF 171



 Score = 87.8 bits (208), Expect = 5e-18
 Identities = 37/50 (74%), Positives = 44/50 (88%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDA 54


>At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 371

 Score =  184 bits (449), Expect = 3e-47
 Identities = 90/118 (76%), Positives = 96/118 (81%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VGDEAQSKRGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPK
Sbjct: 56  VGDEAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPK 115

Query: 435 ANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKGF 608
           ANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI  +GF
Sbjct: 116 ANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPIY-EGF 171



 Score = 87.8 bits (208), Expect = 5e-18
 Identities = 37/50 (74%), Positives = 44/50 (88%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDA 54


>At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293
           Actin 8 {Arabidopsis thaliana}; nearly identical to
           SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and
           to At3g18780
          Length = 377

 Score =  184 bits (449), Expect = 3e-47
 Identities = 90/118 (76%), Positives = 96/118 (81%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VGDEAQSKRGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPK
Sbjct: 56  VGDEAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPK 115

Query: 435 ANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKGF 608
           ANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI  +GF
Sbjct: 116 ANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPIY-EGF 171



 Score = 87.8 bits (208), Expect = 5e-18
 Identities = 37/50 (74%), Positives = 44/50 (88%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDA 54


>At2g42100.1 68415.m05205 actin, putative very strong similarity to
           SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493
           Actin 3 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 378

 Score =  166 bits (403), Expect = 1e-41
 Identities = 77/113 (68%), Positives = 88/113 (77%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VGDEAQ++RGIL+LKYPIEHG+V+NWDDMEKIWHHTFYNELR+ PEEHP+LLTEAPLNPK
Sbjct: 57  VGDEAQARRGILSLKYPIEHGVVSNWDDMEKIWHHTFYNELRLEPEEHPILLTEAPLNPK 116

Query: 435 ANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
            NREKMTQIMFE+F  P+MY+ IQA                SGD G+ H  PI
Sbjct: 117 VNREKMTQIMFESFAFPSMYIGIQAVLSLYSSGRTTGIVLDSGD-GVSHTVPI 168



 Score = 88.2 bits (209), Expect = 4e-18
 Identities = 38/50 (76%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +E  A+V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH+GVMVGM +KD+
Sbjct: 6   DESVAIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHRGVMVGMDEKDT 55


>At2g42170.1 68415.m05219 actin, putative similar to actin 2
           [Arabidopsis thaliana] gi|9293903|dbj|BAB01806
          Length = 329

 Score =  160 bits (388), Expect = 8e-40
 Identities = 68/87 (78%), Positives = 81/87 (93%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           L VGD+A+++ GILTL YP+EHG+V+NWDDMEKIW+HTFY+ELRVAPEEHPVLLTEAPLN
Sbjct: 9   LFVGDDAEARSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPVLLTEAPLN 68

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQA 509
           PKA+REKMTQIMFETF  P+MY+ +QA
Sbjct: 69  PKADREKMTQIMFETFAVPSMYIGMQA 95



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           + LSL+ASGRTTG VLD
Sbjct: 95  AALSLHASGRTTGTVLD 111


>At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin
           11 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 366

 Score =  154 bits (374), Expect = 4e-38
 Identities = 71/96 (73%), Positives = 80/96 (83%)
 Frame = +3

Query: 222 RDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 401
           RDG    E   VG+E  + R ILTLK P+EHGIV NWDDMEKIWH+TFYNELRV PEEHP
Sbjct: 35  RDGLNPNESY-VGEEGHANRDILTLKDPMEHGIVNNWDDMEKIWHYTFYNELRVDPEEHP 93

Query: 402 VLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           VLLTEAP NPKANREKMTQIMFE+F+ PAMYV++Q+
Sbjct: 94  VLLTEAPYNPKANREKMTQIMFESFDVPAMYVSMQS 129



 Score = 52.4 bits (120), Expect = 2e-07
 Identities = 21/32 (65%), Positives = 26/32 (81%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           +V D G GM +AGFAGD+AP+ VFP +VGRPR
Sbjct: 4   IVCDKGHGMVQAGFAGDEAPKVVFPCVVGRPR 35



 Score = 35.5 bits (78), Expect = 0.028
 Identities = 17/25 (68%), Positives = 19/25 (76%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLDFRRRGSST 580
           SVL LY+SGRTTG+VLD   R S T
Sbjct: 129 SVLYLYSSGRTTGVVLDLGERVSHT 153


>At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly
           identical to actin-related protein 2 (ARP2) [Arabidopsis
           thaliana] GI:3818624; contains Pfam profile PF00022:
           Actin
          Length = 389

 Score =  105 bits (251), Expect = 3e-23
 Identities = 48/116 (41%), Positives = 69/116 (59%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           ++VG+     R  L + YP+ +GIV NWDDME +W H FYNEL++ P +  +LLT+ PLN
Sbjct: 53  IVVGETCSELRHQLDINYPVHNGIVQNWDDMEHVWDHAFYNELKINPSDCKILLTDPPLN 112

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPIL 596
           P  NREKM + MFE +N   +++ IQA        +       SGD G+ H  P++
Sbjct: 113 PSKNREKMIETMFEKYNFAGVFIQIQAVLTLYAQGLLTGLVIDSGD-GVTHVVPVV 167



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical
           to actin-related protein 3 (ARP3) [Arabidopsis thaliana]
           GI:21427461; contains Pfam profile PF00022: Actin
          Length = 427

 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 44/88 (50%), Positives = 58/88 (65%), Gaps = 3/88 (3%)
 Frame = +3

Query: 255 VGDEAQSK-RGILT--LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 425
           +GDEA +K R   T  L YPIEHG V +WD ME+ W    +N LR  PE+H  LLTE+PL
Sbjct: 70  IGDEALAKSRSSSTHNLHYPIEHGQVEDWDAMERYWQQCIFNYLRCDPEDHYFLLTESPL 129

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQA 509
            P  +RE   +I+FETFN P +Y+A+ +
Sbjct: 130 TPPESREYTGEILFETFNVPGLYIAVNS 157



 Score = 35.9 bits (79), Expect = 0.021
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           A+V+DNG+G  K GFAG+  P  + P++V
Sbjct: 8   AIVIDNGTGYTKMGFAGNVEPCFILPTVV 36


>At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary
           identical to actin-related protein 4 (ARP4) [Arabidopsis
           thaliana] GI:21427463; contains Pfam profile PF00022:
           Actin; supporting cDNA gi|21427462|gb|AF507912.1|
          Length = 441

 Score = 83.0 bits (196), Expect = 1e-16
 Identities = 37/85 (43%), Positives = 56/85 (65%), Gaps = 1/85 (1%)
 Frame = +3

Query: 249 LLVGDEAQS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 425
           L VG +A S +R  + +  PI+ GIV++WD ++ IW H F + L + P EHP+LL E PL
Sbjct: 75  LYVGSQAMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPL 134

Query: 426 NPKANREKMTQIMFETFNTPAMYVA 500
           N +  REK  ++MFE +  PA+++A
Sbjct: 135 NTQQQREKAAELMFEKYKVPALFMA 159



 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 38


>At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identical
           to actin-related protein 5 (ARP5) GI:21489922 from
           [Arabidopsis thaliana]
          Length = 145

 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = +3

Query: 225 DGRYGTEGLLVGDEAQS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 401
           D   G   L  G +A + +R  + +  P + GIVT+WD ++ +W H F N L + P EHP
Sbjct: 61  DKEKGKRKLYTGSQALNFRRDQMEILSPTKDGIVTDWDMVDNVWDHAFRNCLMIDPTEHP 120

Query: 402 VLLTEAPLNPKANREK 449
           +LL E PLN +  REK
Sbjct: 121 MLLAEPPLNSQQQREK 136



 Score = 57.2 bits (132), Expect = 8e-09
 Identities = 24/34 (70%), Positives = 31/34 (91%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS+VG
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVG 38


>At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical
           to actin-related protein 7 (ARP7) [Arabidopsis thaliana]
           GI:21427469; contains Pfam profile PF00022: Actin
          Length = 363

 Score = 57.2 bits (132), Expect = 8e-09
 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 479
           PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA RE++ Q+MFETFN
Sbjct: 57  PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQLVQLMFETFN 116

Query: 480 TPAMYVAIQA 509
               Y + QA
Sbjct: 117 VSGFYASEQA 126



 Score = 27.5 bits (58), Expect = 7.5
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGR 207
           ALVVD GS   KAG A  D +P  + PS + R
Sbjct: 3   ALVVDAGSKFLKAGAAIPDQSPAMIIPSQMKR 34


>At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly
           identical to actin-related protein 6 (ARP6) [Arabidopsis
           thaliana] GI:21427467; contains Pfam profile PF00022:
           Actin
          Length = 421

 Score = 54.8 bits (126), Expect = 4e-08
 Identities = 24/69 (34%), Positives = 41/69 (59%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 473
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 61  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 120

Query: 474 FNTPAMYVA 500
           F   ++Y+A
Sbjct: 121 FGFSSLYIA 129



 Score = 32.7 bits (71), Expect = 0.20
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V+DNG G+ KAG  G+  P  V P+ + +P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35


>At3g12380.1 68416.m01543 actin/actin-like family protein similar to
           SP|P53946 Actin-like protein ARP5 {Saccharomyces
           cerevisiae}; contains Pfam profile PF00022: Actin
          Length = 724

 Score = 47.2 bits (107), Expect = 9e-06
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 479
           P +  +V  ++ ME I  + F       +  +HP+L+TE   NP  +R KM +++FET+ 
Sbjct: 85  PFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMAELLFETYG 144

Query: 480 TPAMYVAIQA 509
            PA+   + A
Sbjct: 145 VPAVAFGVDA 154



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 17/34 (50%), Positives = 25/34 (73%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
           +V+DNG+   + G+AG+  PR VF +IV RPRH+
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHK 55


>At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase
           family protein similar to laccase [Pinus
           taeda][GI:13661201], lac110 laccase, Populus
           trichocarpa, EMBL:PTY13773
          Length = 584

 Score = 33.9 bits (74), Expect = 0.086
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = -3

Query: 239 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 102
           P P I P  RGL   +G T+  +SSPA+P + +P  +ST +  TS+
Sbjct: 290 PTPDIKP-TRGLIVYQGATS--SSSPAEPLMPVPNDMSTAHRFTSN 332


>At1g16690.2 68414.m01999 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 30.7 bits (66), Expect = 0.80
 Identities = 22/67 (32%), Positives = 29/67 (43%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           LL  D A      L++KY + H I + W +  +IW       L+  P   PV  T  P N
Sbjct: 165 LLQPDAAGEALKYLSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP---PVNDTN-PYN 220

Query: 429 PKANREK 449
               REK
Sbjct: 221 VFRPREK 227


>At1g16690.1 68414.m01998 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 30.7 bits (66), Expect = 0.80
 Identities = 22/67 (32%), Positives = 29/67 (43%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           LL  D A      L++KY + H I + W +  +IW       L+  P   PV  T  P N
Sbjct: 165 LLQPDAAGEALKYLSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP---PVNDTN-PYN 220

Query: 429 PKANREK 449
               REK
Sbjct: 221 VFRPREK 227


>At1g31850.3 68414.m03915 dehydration-responsive protein, putative
           strong similarity to early-responsive to dehydration
           stress ERD3 protein [Arabidopsis thaliana] GI:15320410;
           contains Pfam profile PF03141: Putative
           methyltransferase
          Length = 603

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = -3

Query: 542 RWYDRTRTARARLDGDVHGGRVECFEHD 459
           +W +R   A  R+ GDVHGG     +HD
Sbjct: 405 KWPERLHVAPERI-GDVHGGSANSLKHD 431


>At1g31850.2 68414.m03914 dehydration-responsive protein, putative
           strong similarity to early-responsive to dehydration
           stress ERD3 protein [Arabidopsis thaliana] GI:15320410;
           contains Pfam profile PF03141: Putative
           methyltransferase
          Length = 603

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = -3

Query: 542 RWYDRTRTARARLDGDVHGGRVECFEHD 459
           +W +R   A  R+ GDVHGG     +HD
Sbjct: 405 KWPERLHVAPERI-GDVHGGSANSLKHD 431


>At1g31850.1 68414.m03913 dehydration-responsive protein, putative
           strong similarity to early-responsive to dehydration
           stress ERD3 protein [Arabidopsis thaliana] GI:15320410;
           contains Pfam profile PF03141: Putative
           methyltransferase
          Length = 603

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = -3

Query: 542 RWYDRTRTARARLDGDVHGGRVECFEHD 459
           +W +R   A  R+ GDVHGG     +HD
Sbjct: 405 KWPERLHVAPERI-GDVHGGSANSLKHD 431


>At5g17420.1 68418.m02044 cellulose synthase, catalytic subunit
           (IRX3) identical to gi:5230423
          Length = 1026

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 3/39 (7%)
 Frame = +2

Query: 416 GSPQPQGQQREDDPDHVR---NIQHARHVRRHPSVLSLY 523
           GSP+ +G + E+D D +    NI+H +   +H +   LY
Sbjct: 91  GSPRVEGDEDEEDIDDIEYEFNIEHEQDKHKHSAEAMLY 129


>At3g19480.1 68416.m02469 D-3-phosphoglycerate dehydrogenase,
           putative / 3-PGDH, putative similar to SP:O04130 from
           [Arabidopsis thaliana]
          Length = 588

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = -1

Query: 349 IFSMSSQLVTIPCSMGYLRVRIPLLLCASSPTKSPSVP 236
           IFS SS+LVT P S+  +R R  ++L  SS +     P
Sbjct: 10  IFSSSSRLVTTPSSVFPIRQRRRIILVTSSSSGGGGKP 47


>At5g64580.1 68418.m08116 AAA-type ATPase family protein similar to
           zinc dependent protease [Arabidopsis thaliana]
           GI:7650138; contains Pfam profile PF00004: ATPase AAA
           family
          Length = 855

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 12/46 (26%), Positives = 24/46 (52%)
 Frame = +3

Query: 234 YGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN 371
           Y  +G  +G+E  SK+ I+  ++ ++   +  W+D+ K  H    N
Sbjct: 180 YYKDGEPLGEEEDSKKEIIFRRHIVDRMPIDGWNDVWKKLHQQIVN 225


>At2g41830.1 68415.m05169 cyclin-related contains Pfam profile
           PF02984: Cyclin, C-terminal domain
          Length = 1025

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 14/46 (30%), Positives = 22/46 (47%)
 Frame = -2

Query: 264 HLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHTGAIV 127
           H LL +L+ H DH +++  PS         S +S    + H+  IV
Sbjct: 342 HFLLSMLIKHLDHKSVLKHPSMQLNILEVTSSLSETAKVEHSATIV 387


>At1g28320.1 68414.m03475 protease-related similar to Protease degS
           [Precursor] (SP:P44947) [Haemophilus influenzae];
           similar to DegP protease precursor (GI:2565436)
           [Arabidopsis thaliana]
          Length = 709

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = +2

Query: 518 LYASGRTTGIVLDFRRRGSSTPVPHFTKGIP 610
           L +SG   G+V    R G+ T +PH    IP
Sbjct: 585 LNSSGHMIGLVTSNARHGAGTVIPHLNFSIP 615


>At5g06610.1 68418.m00747 expressed protein contains Pfam profile
           PF04788: Protein of unknown function (DUF620)
          Length = 368

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -3

Query: 215 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSHI 93
           WR  P +  + A+GA  P + AL   +PL+ ++  +S+  +
Sbjct: 167 WRYTPWLGDHAAKGAIRPLRRALQGLDPLTISSVFSSAQFV 207


>At1g02110.1 68414.m00137 proline-rich family protein contains
           proline-rich domain, INTERPRO:IPR000694
          Length = 679

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = -1

Query: 289 RIPLLLCASSPTKSPSVPYRPSRPDGGAFPRS 194
           R+P +L  SSP+ SP+  + P+      + RS
Sbjct: 107 RLPHILSDSSPSSSPATSFYPTAHQNSTYSRS 138


>At4g32410.1 68417.m04614 cellulose synthase, catalytic subunit,
           putative similar to cellulose synthase-1 [gi:9622874]
           and -2 [gi:9622876] from Zea mays
          Length = 1081

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 410 H*GSPQPQGQQREDDPDHVRN 472
           H GSP+ +G + EDD D + N
Sbjct: 91  HRGSPRVEGDEDEDDVDDIEN 111


>At3g12970.1 68416.m01616 expressed protein
          Length = 381

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 12/32 (37%), Positives = 15/32 (46%)
 Frame = +2

Query: 416 GSPQPQGQQREDDPDHVRNIQHARHVRRHPSV 511
           G+P P  + R     H+RN    R  RRH  V
Sbjct: 222 GTPNPFARSRAHHHHHLRNQNQPRKPRRHTQV 253


>At2g43180.4 68415.m05365 expressed protein 
          Length = 466

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 9/30 (30%), Positives = 17/30 (56%)
 Frame = -2

Query: 576 EDPRRRKSSTIPVVRPDAYSESTLGWRRTW 487
           +DP +R+   + V+ P+ Y+E    + R W
Sbjct: 377 DDPEQREDLIVEVITPEVYNEPRNPFSRIW 406


>At2g43180.3 68415.m05363 expressed protein 
          Length = 478

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 9/30 (30%), Positives = 17/30 (56%)
 Frame = -2

Query: 576 EDPRRRKSSTIPVVRPDAYSESTLGWRRTW 487
           +DP +R+   + V+ P+ Y+E    + R W
Sbjct: 376 DDPEQREDLIVEVITPEVYNEPRNPFSRIW 405


>At2g43180.2 68415.m05364 expressed protein 
          Length = 451

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 9/30 (30%), Positives = 17/30 (56%)
 Frame = -2

Query: 576 EDPRRRKSSTIPVVRPDAYSESTLGWRRTW 487
           +DP +R+   + V+ P+ Y+E    + R W
Sbjct: 377 DDPEQREDLIVEVITPEVYNEPRNPFSRIW 406


>At2g43180.1 68415.m05362 expressed protein 
          Length = 479

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 9/30 (30%), Positives = 17/30 (56%)
 Frame = -2

Query: 576 EDPRRRKSSTIPVVRPDAYSESTLGWRRTW 487
           +DP +R+   + V+ P+ Y+E    + R W
Sbjct: 377 DDPEQREDLIVEVITPEVYNEPRNPFSRIW 406


>At2g31900.1 68415.m03897 myosin family protein contains Pfam
           profiles: PF00063 myosin head (motor domain), PF01843
           DIL domain, PF00612 IQ calmodulin-binding motif, PF02736
           myosin N-terminal SH3-like domain
          Length = 1556

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 14/50 (28%), Positives = 24/50 (48%)
 Frame = +3

Query: 327 NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 476
           NW  +E + +    + +   P     LL EA + PK+  E   Q M++T+
Sbjct: 480 NWSYVEFVDNQDVLDLIEKKPGGIIALLDEACMFPKSTHETFAQKMYQTY 529


>At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid
           transfer protein (LTP) family protein similar to auxin
           down regulated GB:X69640 GI:296442 from [Glycine max];
           contains Pfam profile PF00234: Protease inhibitor/seed
           storage/LTP family
          Length = 297

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 2/45 (4%)
 Frame = +3

Query: 462 MFETFNTPAMYVAIQACSRCTR--PVVPPVSCWTSGDGGLPHPCP 590
           +F  F    +   IQAC+ CTR  P VP       G GG   P P
Sbjct: 11  VFLIFTVITLPPTIQACTPCTRPHPPVPKPPQHGGGGGGGSKPPP 55


>At1g55420.1 68414.m06339 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 725

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = -1

Query: 400 GCSSGATRSSL*K-V*CQIFSMSSQLVTIPCSMGYLRVRIPLLLCASSPTKSPSVPY 233
           GC S +  S   + + C+ F +  +  T+PC   Y   R PL LC      + S  Y
Sbjct: 529 GCGSDSCSSYFLECIKCKSF-LGIKCATLPCEAHYTHDRHPLTLCYEEEEDTTSGQY 584


>At1g17540.1 68414.m02157 protein kinase-related similar to
           serine/threonine protein kinase Fen [Lycopersicon
           esculentum] GI:1809259
          Length = 733

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%)
 Frame = +2

Query: 422 PQ-PQGQQREDDPDHVRNIQHARHVRRHPSVLS 517
           PQ PQG      P   +  QH  H  +HPS++S
Sbjct: 160 PQTPQGPHTPQGPQTPQAPQHPPHPSKHPSMMS 192


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,581,588
Number of Sequences: 28952
Number of extensions: 369994
Number of successful extensions: 1176
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 1103
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1162
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1236350304
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).