SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0036
         (602 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g14690.1 68414.m01756 microtubule associated protein (MAP65/A...    30   1.0  
At5g40645.1 68418.m04934 nitrate-responsive NOI protein, putativ...    29   1.8  
At1g60070.1 68414.m06767 gamma-adaptin, putative similar to gamm...    29   3.1  
At5g55220.1 68418.m06883 trigger factor type chaperone family pr...    28   5.5  
At5g32613.1 68418.m03881 zinc knuckle (CCHC-type) family protein...    27   7.2  
At3g05725.1 68416.m00641 expressed protein                             27   7.2  
At1g74160.1 68414.m08589 expressed protein                             27   7.2  
At4g37690.1 68417.m05332 galactosyl transferase GMA12/MNN10 fami...    27   9.6  
At3g50430.1 68416.m05516 expressed protein                             27   9.6  
At2g44950.1 68415.m05596 zinc finger (C3HC4-type RING finger) fa...    27   9.6  
At2g29190.1 68415.m03548 pumilio/Puf RNA-binding domain-containi...    27   9.6  
At2g25410.1 68415.m03043 hypothetical protein                          27   9.6  
At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:...    27   9.6  

>At1g14690.1 68414.m01756 microtubule associated protein
           (MAP65/ASE1) family protein low similarity to SP|P32380
           NUF1 protein (Spindle poly body spacer protein SPC110)
           {Saccharomyces cerevisiae}, smooth muscle myosin heavy
           chain [Homo sapiens] GI:4417214; contains Pfam profile
           PF03999: Microtubule associated protein (MAP65/ASE1
           family)
          Length = 707

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNL 109
           EL  NK++E A  ++    ++ I+ WLS  E +   E+Y +D   +Q+L
Sbjct: 386 ELHINKIKEEAHSRK--EIIDRIDRWLSACEEENWLEEYNQDQKKMQDL 432


>At5g40645.1 68418.m04934 nitrate-responsive NOI protein, putative
           similar to nitrate-induced NOI protein [Zea mays]
           GI:2642213
          Length = 73

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = -3

Query: 405 RTGAAGQQASRRRDNGRRQASA*ARTFC 322
           +T A+G+ AS+RRDN + Q     + FC
Sbjct: 44  KTNASGRAASQRRDNNKSQDEPTKKRFC 71


>At1g60070.1 68414.m06767 gamma-adaptin, putative similar to
           gamma-adaptin GI:2765190 from [Homo sapiens]; contains
           Pfam profiles PF01602: Adaptin N terminal region,
           PF02883: Adaptin C-terminal domain
          Length = 867

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKR 345
           +QKHQN    L    P +DE T  G+R
Sbjct: 581 IQKHQNIRSSLVERMPVLDEATFSGRR 607


>At5g55220.1 68418.m06883 trigger factor type chaperone family
           protein contains Pfam profiles PF05697: Bacterial
           trigger factor protein (TF), PF05698: Bacterial trigger
           factor protein (TF) C-terminus, PF00254: peptidyl-prolyl
           cis-trans isomerase, FKBP-type
          Length = 547

 Score = 27.9 bits (59), Expect = 5.5
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 1/65 (1%)
 Frame = -1

Query: 491 KRES*KFATDDSYLDPTNLNGKVQKH-QNFEQELQANKPRVDEITAVGKRLLELEHFAQP 315
           KRE+ +F+TD+   +  N   + +KH Q F++E    K +V EI    K L  L+  A+ 
Sbjct: 485 KRENLEFSTDELVKEVENSISEFKKHKQEFDEE--RVKDQVQEILEGAKVLEWLKDRAEI 542

Query: 314 QISSR 300
           Q  +R
Sbjct: 543 QYITR 547


>At5g32613.1 68418.m03881 zinc knuckle (CCHC-type) family protein
           contains Pfam domain, PF00098: Zinc knuckle
          Length = 457

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 302 ETIFEVEQNVRAQADA-CRRPLSRRREACWPAAPVRSSDVSAPCHSGWSD 448
           E+  E ++    QA + CRR  S++R A  P+A +   ++      G SD
Sbjct: 369 ESSIEDQKTTTTQAKSKCRRSRSKKRSASLPSASIGPLEIQKGVKEGKSD 418


>At3g05725.1 68416.m00641 expressed protein
          Length = 69

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 14/46 (30%), Positives = 19/46 (41%)
 Frame = +2

Query: 389 PAAPVRSSDVSAPCHSGWSDPSTSRRWRTFSFLVYPTFSFITIAFR 526
           P  P RSS  S      W+DP   R+ R   + +Y     + I  R
Sbjct: 7   PVRPRRSSSHSTLFKGWWNDPEIKRKRRVAKYKLYSAEGKMKITLR 52


>At1g74160.1 68414.m08589 expressed protein
          Length = 1030

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +1

Query: 256 EDCTSRSHIPPSSSTRDDI*G*AKCSSSSRRLPTAVISSTRGL 384
           E  T  S + P SS   +      CSSSS++ P +V++   GL
Sbjct: 249 ERATRNSSVDPKSSKLSESFS-ESCSSSSKKRPPSVVAKLMGL 290


>At4g37690.1 68417.m05332 galactosyl transferase GMA12/MNN10 family
           protein low similarity to
           alpha-1,2-galactosyltransferase, Schizosaccharomyces
           pombe [SP|Q09174]
          Length = 432

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 4/57 (7%)
 Frame = -2

Query: 349 SVCLSSNILLN----LKYRLAWKSWAEYGSDWCSLRAEGKQVAGSGSTTAVQPGRRG 191
           +VCLS  +       +   L W  ++ +   + SLR +GK V  SG      P   G
Sbjct: 12  AVCLSDGVFFLAGAFMSLTLVWSYFSIFSPSFTSLRHDGKPVQCSGLDMQFDPSEPG 68


>At3g50430.1 68416.m05516 expressed protein 
          Length = 642

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 16/36 (44%), Positives = 18/36 (50%)
 Frame = +2

Query: 242 FPFSSKTAPVAPIFRPALPRETIFEVEQNVRAQADA 349
           FPF   T   +P  R  LP  +  EVEQN R  A A
Sbjct: 563 FPFEGSTDAPSPKRRKVLPETS--EVEQNWRLHAQA 596


>At2g44950.1 68415.m05596 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 878

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 11/88 (12%)
 Frame = -3

Query: 294 RAGRNMGATGAVFELK--GNKLQEAAQQQQYNRAVEDIELWLSEV----EGQL-----LS 148
           RA R+  A GA F +   GNKL  + +++   R ++D+E  L E+     G+L     L 
Sbjct: 270 RAERDATA-GAFFPVLSLGNKLATSDRERDKQRDLQDMETVLKELTVLASGRLQQLKNLH 328

Query: 147 EDYGKDLTSVQNLQKKHALLEADVSSHA 64
           E+  K L  + NLQ K   +    SS A
Sbjct: 329 EERTKMLGKMSNLQNKSKSVRCISSSQA 356


>At2g29190.1 68415.m03548 pumilio/Puf RNA-binding domain-containing
            protein 
          Length = 972

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 3/45 (6%)
 Frame = -1

Query: 431  GKVQKHQNFEQELQANK---PRVDEITAVGKRLLELEHFAQPQIS 306
            G+++ H N  ++    K    RV+++ A G+R + L+   QPQ++
Sbjct: 928  GRIKVHLNALKKYTYGKHIVARVEKLVAAGERRMALQSLTQPQMA 972


>At2g25410.1 68415.m03043 hypothetical protein
          Length = 377

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 449 PSTSRRWRTFSFLVYPTFSFITIAFRTVDTL 541
           P +  R R ++FL+ P  + IT +FR +D L
Sbjct: 114 PFSFLRSRNYTFLICPKEANITASFRAIDCL 144


>At1g04600.1 68414.m00454 myosin, putative similar to myosin
            (GI:499047) [Arabidopsis thaliana]
          Length = 1730

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 18/63 (28%), Positives = 32/63 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KLQ    Q+  ++ + D++  L ++  QL  E+  K L    +L  ++  L+  VSS   
Sbjct: 958  KLQLRDTQETKSKEISDLQSALQDM--QLEIEELSKGLEMTNDLAAENEQLKESVSSLQN 1015

Query: 60   RID 52
            +ID
Sbjct: 1016 KID 1018


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,495,917
Number of Sequences: 28952
Number of extensions: 241792
Number of successful extensions: 916
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 891
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 916
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1197101088
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).