SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0035
         (392 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S...    99   1e-21
At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496...    99   1e-21
At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A...    98   2e-21
At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A...    98   2e-21
At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497...    98   2e-21
At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A...    98   2e-21
At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A...    96   7e-21
At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A...    96   7e-21
At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A...    96   7e-21
At2g42100.1 68415.m05205 actin, putative very strong similarity ...    89   8e-19
At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara...    64   3e-11
At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identica...    56   9e-09
At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id...    56   1e-08
At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac...    55   2e-08
At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i...    44   4e-05
At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica...    36   0.013
At3g12380.1 68416.m01543 actin/actin-like family protein similar...    34   0.040
At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i...    30   0.49 
At3g03720.1 68416.m00377 amino acid permease family protein simi...    29   1.1  
At5g56180.2 68418.m07009 actin-related protein, putative (ARP8) ...    29   1.5  
At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) ...    29   1.5  
At2g17480.1 68415.m02019 seven transmembrane MLO family protein ...    29   1.5  
At2g22330.1 68415.m02649 cytochrome P450, putative similar to cy...    28   2.6  
At1g66270.2 68414.m07524 beta-glucosidase (PSR3.2) nearly identi...    27   4.5  
At1g66270.1 68414.m07523 beta-glucosidase (PSR3.2) nearly identi...    27   4.5  
At5g02830.1 68418.m00225 pentatricopeptide (PPR) repeat-containi...    27   6.0  
At5g36940.1 68418.m04430 amino acid permease family protein simi...    26   7.9  
At3g61550.1 68416.m06894 zinc finger (C3HC4-type RING finger) fa...    26   7.9  

>At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to
           SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana}
          Length = 377

 Score = 98.7 bits (235), Expect = 1e-21
 Identities = 42/47 (89%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI +NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84



 Score = 60.1 bits (139), Expect = 5e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496
           Actin 11 {Arabidopsis thaliana}
          Length = 377

 Score = 98.7 bits (235), Expect = 1e-21
 Identities = 42/47 (89%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI +NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84



 Score = 60.1 bits (139), Expect = 5e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494
           Actin 4 {Arabidopsis thaliana}
          Length = 377

 Score = 98.3 bits (234), Expect = 2e-21
 Identities = 42/47 (89%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI  NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDM 84



 Score = 60.1 bits (139), Expect = 5e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493
           Actin 3 {Arabidopsis thaliana}; supported by full-length
           cDNA: Ceres: 19581.
          Length = 377

 Score = 98.3 bits (234), Expect = 2e-21
 Identities = 42/47 (89%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI  NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDM 84



 Score = 60.1 bits (139), Expect = 5e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497
           Actin 12 {Arabidopsis thaliana}
          Length = 377

 Score = 98.3 bits (234), Expect = 2e-21
 Identities = 42/47 (89%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI  NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDM 84



 Score = 60.1 bits (139), Expect = 5e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671
           Actin 1 (Actin 3) {Arabidopsis thaliana}
          Length = 377

 Score = 98.3 bits (234), Expect = 2e-21
 Identities = 42/47 (89%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI  NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDM 84



 Score = 60.1 bits (139), Expect = 5e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 377

 Score = 96.3 bits (229), Expect = 7e-21
 Identities = 40/47 (85%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGM QKD+YVGDEAQSKRGILTLKYPIEHG+ +NWDDM
Sbjct: 38  GRPRHHGVMVGMNQKDAYVGDEAQSKRGILTLKYPIEHGVVSNWDDM 84



 Score = 57.6 bits (133), Expect = 3e-09
 Identities = 24/36 (66%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +++  +V DNG+GM KAGFAG DAPRAVFPS+VG P
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRP 40


>At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 371

 Score = 96.3 bits (229), Expect = 7e-21
 Identities = 40/47 (85%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGM QKD+YVGDEAQSKRGILTLKYPIEHG+ +NWDDM
Sbjct: 38  GRPRHHGVMVGMNQKDAYVGDEAQSKRGILTLKYPIEHGVVSNWDDM 84



 Score = 57.6 bits (133), Expect = 3e-09
 Identities = 24/36 (66%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +++  +V DNG+GM KAGFAG DAPRAVFPS+VG P
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRP 40


>At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293
           Actin 8 {Arabidopsis thaliana}; nearly identical to
           SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and
           to At3g18780
          Length = 377

 Score = 96.3 bits (229), Expect = 7e-21
 Identities = 40/47 (85%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGM QKD+YVGDEAQSKRGILTLKYPIEHG+ +NWDDM
Sbjct: 38  GRPRHHGVMVGMNQKDAYVGDEAQSKRGILTLKYPIEHGVVSNWDDM 84



 Score = 57.6 bits (133), Expect = 3e-09
 Identities = 24/36 (66%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +++  +V DNG+GM KAGFAG DAPRAVFPS+VG P
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRP 40


>At2g42100.1 68415.m05205 actin, putative very strong similarity to
           SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493
           Actin 3 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 378

 Score = 89.4 bits (212), Expect = 8e-19
 Identities = 35/47 (74%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH+GVMVGM +KD++VGDEAQ++RGIL+LKYPIEHG+ +NWDDM
Sbjct: 39  GRPRHRGVMVGMDEKDTFVGDEAQARRGILSLKYPIEHGVVSNWDDM 85



 Score = 59.7 bits (138), Expect = 7e-10
 Identities = 27/39 (69%), Positives = 31/39 (79%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           +E  A+V DNG+GM KAGFAG DAPRAVFPS+VG P  R
Sbjct: 6   DESVAIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHR 44


>At2g42170.1 68415.m05219 actin, putative similar to actin 2
           [Arabidopsis thaliana] gi|9293903|dbj|BAB01806
          Length = 329

 Score = 64.1 bits (149), Expect = 3e-11
 Identities = 24/39 (61%), Positives = 33/39 (84%)
 Frame = +1

Query: 274 MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           MVGM + D +VGD+A+++ GILTL YP+EHG+ +NWDDM
Sbjct: 1   MVGMNENDLFVGDDAEARSGILTLDYPMEHGVVSNWDDM 39


>At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identical
           to actin-related protein 5 (ARP5) GI:21489922 from
           [Arabidopsis thaliana]
          Length = 145

 Score = 56.0 bits (129), Expect = 9e-09
 Identities = 24/35 (68%), Positives = 31/35 (88%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGS 256
           +EV+A+VVD GS  CKAG+AG DAP+AVFPS+VG+
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGA 39


>At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary
           identical to actin-related protein 4 (ARP4) [Arabidopsis
           thaliana] GI:21427463; contains Pfam profile PF00022:
           Actin; supporting cDNA gi|21427462|gb|AF507912.1|
          Length = 441

 Score = 55.6 bits (128), Expect = 1e-08
 Identities = 23/35 (65%), Positives = 31/35 (88%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGS 256
           +EV+A+VVD GS  CKAG+AG DAP+AVFPS++G+
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGA 39



 Score = 27.1 bits (57), Expect = 4.5
 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 1/29 (3%)
 Frame = +1

Query: 301 YVGDEAQS-KRGILTLKYPIEHGIATNWD 384
           YVG +A S +R  + +  PI+ GI ++WD
Sbjct: 76  YVGSQAMSYRRDHMEVLSPIKDGIVSDWD 104


>At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin
           11 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 366

 Score = 54.8 bits (126), Expect = 2e-08
 Identities = 22/37 (59%), Positives = 27/37 (72%)
 Frame = +1

Query: 280 GMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+   +SYVG+E  + R ILTLK P+EHGI  NWDDM
Sbjct: 37  GLNPNESYVGEEGHANRDILTLKDPMEHGIVNNWDDM 73



 Score = 44.4 bits (100), Expect = 3e-05
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V D G GM +AGFAG +AP+ VFP +VG P
Sbjct: 4   IVCDKGHGMVQAGFAGDEAPKVVFPCVVGRP 34


>At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly
           identical to actin-related protein 2 (ARP2) [Arabidopsis
           thaliana] GI:3818624; contains Pfam profile PF00022:
           Actin
          Length = 389

 Score = 44.0 bits (99), Expect = 4e-05
 Identities = 18/34 (52%), Positives = 24/34 (70%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           +V DNG+G  K GFAG + P +VFP +VG P +R
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLR 40



 Score = 39.1 bits (87), Expect = 0.001
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = +1

Query: 250 GKP--RHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P  R++  ++    KD  VG+     R  L + YP+ +GI  NWDDM
Sbjct: 35  GRPLLRYEESLMEQQVKDIVVGETCSELRHQLDINYPVHNGIVQNWDDM 83


>At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical
           to actin-related protein 3 (ARP3) [Arabidopsis thaliana]
           GI:21427461; contains Pfam profile PF00022: Actin
          Length = 427

 Score = 35.5 bits (78), Expect = 0.013
 Identities = 19/35 (54%), Positives = 22/35 (62%), Gaps = 3/35 (8%)
 Frame = +1

Query: 295 DSYVGDEAQSK-RGILT--LKYPIEHGIATNWDDM 390
           D Y+GDEA +K R   T  L YPIEHG   +WD M
Sbjct: 67  DFYIGDEALAKSRSSSTHNLHYPIEHGQVEDWDAM 101



 Score = 34.7 bits (76), Expect = 0.023
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A+V+DNG+G  K GFAG   P  + P++V
Sbjct: 8   AIVIDNGTGYTKMGFAGNVEPCFILPTVV 36


>At3g12380.1 68416.m01543 actin/actin-like family protein similar to
           SP|P53946 Actin-like protein ARP5 {Saccharomyces
           cerevisiae}; contains Pfam profile PF00022: Actin
          Length = 724

 Score = 33.9 bits (74), Expect = 0.040
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +V+DNG+   + G+AG   PR VF +IV  P  +A
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKA 56


>At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly
           identical to actin-related protein 6 (ARP6) [Arabidopsis
           thaliana] GI:21427467; contains Pfam profile PF00022:
           Actin
          Length = 421

 Score = 30.3 bits (65), Expect = 0.49
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNG G+ KAG  G   P  V P+ +  P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35


>At3g03720.1 68416.m00377 amino acid permease family protein similar
           to cationic amino acid transporter-1 [Rattus norvegicus]
           GI:1589917; contains Pfam profile PF00324: Amino acid
           permease
          Length = 600

 Score = 29.1 bits (62), Expect = 1.1
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFP 241
           ++V  G   CK G+ GYD P   FP
Sbjct: 198 IIVVGGYLACKTGWVGYDLPSGYFP 222


>At5g56180.2 68418.m07009 actin-related protein, putative (ARP8)
           strong similarity to actin-related protein 8A (ARP8)
           [Arabidopsis thaliana] GI:21427473; contains Pfam
           profile PF00022: Actin; supporting cDNA
           gi|21427470|gb|AF507916.1|
          Length = 387

 Score = 28.7 bits (61), Expect = 1.5
 Identities = 9/21 (42%), Positives = 16/21 (76%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAP 226
           ++++D GSG CK G++ Y +P
Sbjct: 135 SIIIDGGSGYCKFGWSKYASP 155


>At5g56180.1 68418.m07008 actin-related protein, putative (ARP8)
           strong similarity to actin-related protein 8A (ARP8)
           [Arabidopsis thaliana] GI:21427473; contains Pfam
           profile PF00022: Actin; supporting cDNA
           gi|21427470|gb|AF507916.1|
          Length = 471

 Score = 28.7 bits (61), Expect = 1.5
 Identities = 9/21 (42%), Positives = 16/21 (76%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAP 226
           ++++D GSG CK G++ Y +P
Sbjct: 135 SIIIDGGSGYCKFGWSKYASP 155


>At2g17480.1 68415.m02019 seven transmembrane MLO family protein /
           MLO-like protein 8 (MLO8) identical to membrane protein
           Mlo8 [Arabidopsis thaliana] gi|14091586|gb|AAK53801;
           similar to MLO protein SWISS-PROT:P93766,
           NCBI_gi:1877221 [Hordeum vulgare][Barley]
          Length = 593

 Score = 28.7 bits (61), Expect = 1.5
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -3

Query: 300 RVLLSHTDHHALMAGLPTIEGN 235
           R+ L  TD HA++ G+P ++GN
Sbjct: 355 RMALGITDRHAVVQGMPLVQGN 376


>At2g22330.1 68415.m02649 cytochrome P450, putative similar to
           cytochrome P450 79B2 (SP:O81346) [Arabidopsis thaliana]
          Length = 543

 Score = 27.9 bits (59), Expect = 2.6
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = -3

Query: 390 HVIPVSGDSVFDGVFEGQDTSFALCLISYIRVLLSH 283
           HVIPV+   +   +F+ QD  FA   ++Y + +LS+
Sbjct: 104 HVIPVTCPKIAREIFKQQDALFASRPLTYAQKILSN 139


>At1g66270.2 68414.m07524 beta-glucosidase (PSR3.2) nearly identical
           to GI:2286069 from (Arabidopsis thaliana) (Plant Mol.
           Biol. 34 (1), 57-68 (1997)); similar to thioglucoside
           glucohydrolase (GI:984052) [Arabidopsis thaliana]
          Length = 522

 Score = 27.1 bits (57), Expect = 4.5
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 4/58 (6%)
 Frame = -2

Query: 256 ASHDRGK----HCARSIISCEAGLAHTGAIVYYQRGNFFVAHLELVKLVRCRCDKMKI 95
           A +D GK     C+R +  CE     +G   Y    N   AH E V++ R +    KI
Sbjct: 209 AGYDLGKKAPGRCSRYVPGCEDREGQSGKEAYLVSHNLLNAHAEAVEVFRQKVKGGKI 266


>At1g66270.1 68414.m07523 beta-glucosidase (PSR3.2) nearly identical
           to GI:2286069 from (Arabidopsis thaliana) (Plant Mol.
           Biol. 34 (1), 57-68 (1997)); similar to thioglucoside
           glucohydrolase (GI:984052) [Arabidopsis thaliana]
          Length = 524

 Score = 27.1 bits (57), Expect = 4.5
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 4/58 (6%)
 Frame = -2

Query: 256 ASHDRGK----HCARSIISCEAGLAHTGAIVYYQRGNFFVAHLELVKLVRCRCDKMKI 95
           A +D GK     C+R +  CE     +G   Y    N   AH E V++ R +    KI
Sbjct: 211 AGYDLGKKAPGRCSRYVPGCEDREGQSGKEAYLVSHNLLNAHAEAVEVFRQKVKGGKI 268


>At5g02830.1 68418.m00225 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 852

 Score = 26.6 bits (56), Expect = 6.0
 Identities = 16/54 (29%), Positives = 21/54 (38%), Gaps = 4/54 (7%)
 Frame = -3

Query: 285 HTDHHALMAGLPTIEGNTARGASY----PAKPALHIPEPLSTTNAATSSSHILN 136
           H  H    A  P     T   +S+    P+ P  H P P S +   + SSH  N
Sbjct: 18  HHHHRRCYATAPESNRKTKSNSSFTKLLPSLPQQHSPSPASVSATHSLSSHFSN 71


>At5g36940.1 68418.m04430 amino acid permease family protein similar
           to SP|Q09143 High-affinity cationic amino acid
           transporter-1 (CAT-1) {Mus musculus}; contains Pfam
           profile PF00324: Amino acid permease
          Length = 609

 Score = 26.2 bits (55), Expect = 7.9
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = +2

Query: 158 VAALVVDNGSGMC-KAGFAGYDAPRAVFP 241
           V   V+  GS +C K G+ GY+ P   FP
Sbjct: 199 VMIFVIVAGSYLCFKTGWVGYELPTGYFP 227


>At3g61550.1 68416.m06894 zinc finger (C3HC4-type RING finger)
           family protein similar to RING-H2 zinc finger protein
           ATL6 [Arabidopsis thaliana] GI:4928403; contains Pfam
           profile PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 212

 Score = 26.2 bits (55), Expect = 7.9
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = -3

Query: 378 VSGDSVFDGVFEGQDTSFALCLISYI 301
           V+GD   DG  EG++T+ ++CL  Y+
Sbjct: 121 VNGDGFHDG--EGRETTCSICLCEYM 144


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,530,314
Number of Sequences: 28952
Number of extensions: 211047
Number of successful extensions: 613
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 566
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 613
length of database: 12,070,560
effective HSP length: 73
effective length of database: 9,957,064
effective search space used: 567552648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).