SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0034
         (628 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g55060.1 68416.m06115 expressed protein contains weak similar...    31   0.47 
At2g27120.1 68415.m03259 DNA-directed DNA polymerase epsilon cat...    28   5.8  

>At3g55060.1 68416.m06115 expressed protein contains weak similarity
           to intracellular protein transport protein USO1
           (Swiss-Prot:P25386) [Saccharomyces cerevisiae];
           expression supported by MPSS
          Length = 896

 Score = 31.5 bits (68), Expect = 0.47
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +1

Query: 223 ESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGS 375
           E+ K EL  S+ +  DRRR  S    +P +QV   +   +KF+H  +   S
Sbjct: 73  ETSKNELTTSATKSKDRRRNHSSRCFTPERQVRERQCKADKFQHDSSGSSS 123


>At2g27120.1 68415.m03259 DNA-directed DNA polymerase epsilon
           catalytic subunit, putative similar to SP|Q07864 DNA
           polymerase epsilon, catalytic subunit A (EC 2.7.7.7)
           (DNA polymerase II subunit A) {Homo sapiens}; contains
           Pfam profiles: PF03175 DNA polymerase type B, organellar
           and viral, PF00136 DNA polymerase family B, PF03104 DNA
           polymerase family B, exonuclease domain
          Length = 2138

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 13/48 (27%), Positives = 25/48 (52%)
 Frame = +1

Query: 415 VLVIKKVHDAQILAPFVQLVHWLVHDKSMVVVRRGGSFWMTHSFAGVL 558
           ++ I++ HD  ++   +QL H  + +     V R G+ W +   AGV+
Sbjct: 753 LIKIQEAHDMVVVYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGVV 800


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,075,600
Number of Sequences: 28952
Number of extensions: 339121
Number of successful extensions: 860
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 835
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 860
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1275599520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).