SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0028
         (633 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g25540.1 68414.m03171 phytochrome and flowering time regulato...    31   0.48 
At1g15780.1 68414.m01893 expressed protein                             31   0.48 
At1g24300.1 68414.m03066 GYF domain-containing protein contains ...    30   1.5  
At1g06070.1 68414.m00636 bZIP transcription factor, putative (bZ...    30   1.5  
At1g27430.1 68414.m03343 GYF domain-containing protein contains ...    29   1.9  
At5g62090.2 68418.m07793 expressed protein                             29   2.6  
At5g62090.1 68418.m07792 expressed protein                             29   2.6  
At1g43850.1 68414.m05052 SEUSS transcriptional co-regulator iden...    29   2.6  
At1g30330.1 68414.m03709 auxin-responsive factor (ARF6) identica...    29   2.6  
At2g26350.1 68415.m03163 zinc-binding peroxisomal integral membr...    29   3.4  
At1g69280.1 68414.m07943 expressed protein                             29   3.4  
At1g32190.1 68414.m03959 expressed protein                             29   3.4  
At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family...    28   4.5  
At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family...    28   4.5  
At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol p...    28   4.5  
At1g26820.1 68414.m03268 ribonuclease 3 (RNS3) identical to ribo...    28   4.5  
At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co...    28   5.9  
At1g55080.1 68414.m06291 expressed protein                             28   5.9  
At5g36740.1 68418.m04402 PHD finger family protein                     27   7.8  
At5g36670.1 68418.m04388 PHD finger family protein                     27   7.8  
At5g01480.1 68418.m00061 DC1 domain-containing protein contains ...    27   7.8  
At3g10390.1 68416.m01245 amine oxidase family protein / SWIRM do...    27   7.8  
At1g17440.2 68414.m02133 transcription initiation factor IID (TF...    27   7.8  
At1g17440.1 68414.m02132 transcription initiation factor IID (TF...    27   7.8  

>At1g25540.1 68414.m03171 phytochrome and flowering time regulatory
           protein (PFT1) PMID: 12815435
          Length = 836

 Score = 31.5 bits (68), Expect = 0.48
 Identities = 18/60 (30%), Positives = 32/60 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q + Q+Q + ++     +Q QH   +Q +MP L QQ+  H  +QQ+  +  QL   Q +
Sbjct: 686 QQQLHQQQQQQQQIQQQQQQQQH--LQQQQMPQLQQQQQQHQQQQQQQHQLSQLQHHQQQ 743



 Score = 27.9 bits (59), Expect = 5.9
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQ-QKVQRRVQL*EQQM 262
           +Q  QQ+  + ++    L+Q Q    +Q +     QQ+  H L Q Q  Q++ Q  +QQ 
Sbjct: 692 QQQQQQQIQQQQQQQQHLQQQQMPQLQQQQQQHQQQQQQQHQLSQLQHHQQQQQQQQQQQ 751

Query: 261 ELHR 250
           + H+
Sbjct: 752 QQHQ 755



 Score = 27.9 bits (59), Expect = 5.9
 Identities = 18/66 (27%), Positives = 33/66 (50%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
           ++      +QH+QQ+Q    +     +QHQ    +QH++  L Q       +QQ+ Q++ 
Sbjct: 698 QIQQQQQQQQHLQQQQMPQLQQQQ--QQHQQQQQQQHQLSQL-QHHQQQQQQQQQQQQQH 754

Query: 282 QL*EQQ 265
           QL + Q
Sbjct: 755 QLTQLQ 760



 Score = 27.5 bits (58), Expect = 7.8
 Identities = 17/71 (23%), Positives = 37/71 (52%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKV 295
           G+++     + ++Q  QQ+Q   ++     +Q Q    +Q +   L QQ++P L +QQ+ 
Sbjct: 669 GDMVVFKPQIPNQQQQQQQQLHQQQ-----QQQQQIQQQQQQQQHLQQQQMPQLQQQQQQ 723

Query: 294 QRRVQL*EQQM 262
            ++ Q  + Q+
Sbjct: 724 HQQQQQQQHQL 734


>At1g15780.1 68414.m01893 expressed protein
          Length = 1335

 Score = 31.5 bits (68), Expect = 0.48
 Identities = 16/45 (35%), Positives = 26/45 (57%)
 Frame = -1

Query: 393 AGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           + L QHQH   +Q +   L QQ     ++QQ++Q R Q  +QQ++
Sbjct: 822 SSLLQHQHLKQQQDQQMQLKQQFQQRQMQQQQLQARQQQQQQQLQ 866


>At1g24300.1 68414.m03066 GYF domain-containing protein contains
           Pfam profile: PF02213 GYF domain
          Length = 1417

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 6/83 (7%)
 Frame = -1

Query: 480 HTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPL-LGQQEVPHLLEQ 304
           H  N   + D + S QH QQ Q + R+ L+       +    + + L L QQ+   L +Q
Sbjct: 664 HLSNRFNLGDQLSSNQHNQQ-QFQNRDMLSHSHIGDQAQDLDYLITLQLQQQQKIQLQQQ 722

Query: 303 QKV----QRRVQL*EQQ-MELHR 250
           QK+    Q+++QL +QQ M+L +
Sbjct: 723 QKIQLQQQQKIQLQQQQKMQLQQ 745



 Score = 29.5 bits (63), Expect = 1.9
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = -1

Query: 387 LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           L+Q Q    +Q +   L QQ+   L +QQK+Q +    EQ+ +LH+
Sbjct: 711 LQQQQKIQLQQQQKIQLQQQQKIQLQQQQKMQLQQHQLEQEHQLHQ 756


>At1g06070.1 68414.m00636 bZIP transcription factor, putative
           (bZIP69) similar to transcriptional activator RF2a
           GB:AF005492 GI:2253277 from [Oryza sativa]; contains
           Pfam profile PF00170: bZIP transcription factor
          Length = 423

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 15/52 (28%), Positives = 29/52 (55%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           Q +QQ Q + ++     +QHQ    +Q +     QQ++  L +QQ++Q++ Q
Sbjct: 340 QQLQQLQIQSQKQQQQQQQHQQQQQQQQQQFHFQQQQLYQLQQQQRLQQQEQ 391


>At1g27430.1 68414.m03343 GYF domain-containing protein contains
           Pfam profile: PF02213 GYF domain
          Length = 1531

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 7/84 (8%)
 Frame = -1

Query: 480 HTGNVLEVLDHMGSRQHMQQEQGECREPLAGLE------QHQHSMAKQHRMPL-LGQQEV 322
           H  N     D + S QH QQ   + R+ L+ L       +H  ++  Q +  + + QQ+ 
Sbjct: 743 HESNFFNHGDQLPSNQHHQQHF-QNRDMLSHLHIGDQDLEHLITLQLQQQQKIQMQQQQK 801

Query: 321 PHLLEQQKVQRRVQL*EQQMELHR 250
             L +QQK+Q +    EQ+ +LH+
Sbjct: 802 IQLQQQQKIQLQQHQLEQEHQLHQ 825


>At5g62090.2 68418.m07793 expressed protein
          Length = 816

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 19/60 (31%), Positives = 33/60 (55%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+QG+  +    L+Q +    +Q+   L   Q V  L +QQ+VQ++ QL +Q  +
Sbjct: 208 QQQQQQQQGQNPQFQILLQQQKLRQQQQYLQSLPPLQRV-QLQQQQQVQQQQQLQQQHQQ 266


>At5g62090.1 68418.m07792 expressed protein
          Length = 816

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 19/60 (31%), Positives = 33/60 (55%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+QG+  +    L+Q +    +Q+   L   Q V  L +QQ+VQ++ QL +Q  +
Sbjct: 208 QQQQQQQQGQNPQFQILLQQQKLRQQQQYLQSLPPLQRV-QLQQQQQVQQQQQLQQQHQQ 266


>At1g43850.1 68414.m05052 SEUSS transcriptional co-regulator
           identical to SEUSS transcriptional co-regulator
           [Arabidopsis thaliana] gi|18033922|gb|AAL57277
          Length = 877

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 18/61 (29%), Positives = 31/61 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           RQ  QQ+Q +  +      Q Q ++ +Q R+  L QQ++   + QQ+ Q   Q  +Q + 
Sbjct: 233 RQQQQQQQQQFLQMPGQSPQAQMNIFQQQRLMQLQQQQLLKSMPQQRPQLPQQFQQQNLP 292

Query: 258 L 256
           L
Sbjct: 293 L 293


>At1g30330.1 68414.m03709 auxin-responsive factor (ARF6) identical
           to ARF6 [Arabidopsis thaliana] GI:4102600 (Science 276
           (5320), 1865-1868 (1997))
          Length = 933

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 18/60 (30%), Positives = 33/60 (55%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q +QQ+  + ++ L+  +Q Q  +++Q +  L  QQ+    L QQ+ Q+  Q  +QQ  L
Sbjct: 480 QMLQQQLSQQQQQLSQQQQQQQQLSQQQQQQLSQQQQ--QQLSQQQQQQLSQQQQQQAYL 537



 Score = 27.5 bits (58), Expect = 7.8
 Identities = 17/74 (22%), Positives = 30/74 (40%)
 Frame = -1

Query: 426 QQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRG 247
           QQ+  + ++    L Q Q     Q +   L QQ+   L +QQ+ Q  + + E      + 
Sbjct: 490 QQQLSQQQQQQQQLSQQQQQQLSQQQQQQLSQQQQQQLSQQQQQQAYLGVPETHQPQSQA 549

Query: 246 YGRSEGRCCYQRTQ 205
             +S      Q+ Q
Sbjct: 550 QSQSNNHLSQQQQQ 563


>At2g26350.1 68415.m03163 zinc-binding peroxisomal integral membrane
           protein (PEX10) identical to zinc-binding peroxisomal
           integral membrane protein GI:4337011 from [Arabidopsis
           thaliana]
          Length = 381

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = +2

Query: 290 RCTFCCSNRCGTSCCPSSGILCCFAILCWC 379
           +CT C S R   +  P   + C   I+ WC
Sbjct: 326 KCTLCLSTRQHPTATPCGHVFCWSCIMEWC 355


>At1g69280.1 68414.m07943 expressed protein
          Length = 400

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 11/30 (36%), Positives = 14/30 (46%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSS 343
           C    C Y+ +    FCC   C + CC SS
Sbjct: 339 CRWPSCDYNSSCGWLFCCHWSCWSCCCCSS 368


>At1g32190.1 68414.m03959 expressed protein
          Length = 422

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 26/81 (32%), Positives = 29/81 (35%), Gaps = 8/81 (9%)
 Frame = +2

Query: 227 RPSL-LP*PLCNSICCSYSCTLRCTFCCSNRCGT-----SCC--PSSGILCCFAILCWCC 382
           RPS   P P C    CS  C      C    C T     SCC  PS    CC     + C
Sbjct: 302 RPSCSCPKPRCPKPSCSCGCGCGDCGCFKCSCPTLKGCFSCCKKPSCVSSCCCPT--FKC 359

Query: 383 SNPASGSLHSPCSCCICCRLP 445
           S+         CSC  C + P
Sbjct: 360 SSCFGKPKCPKCSCWKCLKCP 380


>At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family
           protein contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 199

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 4/24 (16%)
 Frame = +2

Query: 305 CSNRCGTSCCP----SSGILCCFA 364
           CS RCG + CP    ++ + CCFA
Sbjct: 13  CSGRCGEAKCPQLCLATEVFCCFA 36


>At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family
           protein contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 255

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 4/24 (16%)
 Frame = +2

Query: 305 CSNRCGTSCCP----SSGILCCFA 364
           CS RCG + CP    ++ + CCFA
Sbjct: 69  CSGRCGEAKCPQLCLATEVFCCFA 92


>At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol
           protease, putative contains similarity to cysteine
           proteinase RD21A (thiol protease) GI:435619, SP:P43297
           from [Arabidopsis thaliana]
          Length = 452

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 22/72 (30%), Positives = 30/72 (41%), Gaps = 1/72 (1%)
 Frame = +2

Query: 257 NSICCSYSCT-LRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           N  C S+ C       CC +  G+SCCP S  +C         +N      +SP S    
Sbjct: 382 NGKCYSWGCCPYESATCCDD--GSSCCPQSYPVCDLK------ANTCRMKGNSPLSIKAL 433

Query: 434 CRLPIWSSTSST 469
            R P  ++T ST
Sbjct: 434 TRGPAIATTKST 445


>At1g26820.1 68414.m03268 ribonuclease 3 (RNS3) identical to
           ribonuclease SP:P42815 Ribonuclease 3 precursor (EC
           3.1.27.1) {Arabidopsis thaliana}
          Length = 222

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = -1

Query: 246 YGRSEGRCCYQRTQCPAGDINLCSVWRN 163
           Y  S   CCY +T  PA D  +  +W N
Sbjct: 35  YCDSRHSCCYPQTGKPAADFGIHGLWPN 62


>At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG)
           contains seven G-protein beta WD-40 repeats; beta
           transducin-like protein, Podospora anserina, gb:L28125;
           contains Pfam profiles PF04503:  Single-stranded DNA
           binding protein, SSDP; PF00400:WD domain, G-beta repeat;
           identical to cDNA LEUNIG (LEUNIG) GI:11141604
          Length = 931

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 22/93 (23%), Positives = 42/93 (45%)
 Frame = -1

Query: 510 SSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ 331
           S IE  +++     + +      S+Q  QQ+Q + +     L++ Q    +Q       Q
Sbjct: 77  SYIETQMIKAREQQLQQSQHPQVSQQQQQQQQQQIQMQQLLLQRAQQQQQQQQ------Q 130

Query: 330 QEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSE 232
           Q   H  +QQ+ Q++ Q  +QQ + H+    S+
Sbjct: 131 QHHHHQQQQQQQQQQQQQQQQQQQQHQNQPPSQ 163


>At1g55080.1 68414.m06291 expressed protein
          Length = 244

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 16/60 (26%), Positives = 32/60 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q +QQ+Q + ++    L+Q Q +  +Q +     QQE+    + Q+ Q  +Q  +QQ +
Sbjct: 37  QQQLQQQQQQQQQQQFHLQQQQQTQQQQQQFQPQQQQEMQQYQQFQQQQHFIQ--QQQFQ 94


>At5g36740.1 68418.m04402 PHD finger family protein
          Length = 1179

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = -1

Query: 489 VQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLE 382
           ++IH GN L  +  +G+R +M + QG CR  + G+E
Sbjct: 868 IRIH-GNQLAEMPFIGTR-YMYRRQGMCRRLMDGIE 901


>At5g36670.1 68418.m04388 PHD finger family protein
          Length = 1193

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = -1

Query: 489 VQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLE 382
           ++IH GN L  +  +G+R +M + QG CR  + G+E
Sbjct: 868 IRIH-GNQLAEMPFIGTR-YMYRRQGMCRRLMDGIE 901


>At5g01480.1 68418.m00061 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 413

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSP 415
           CCS + G         +C FA+   C  NP S ++ +P
Sbjct: 137 CCSCKRGVDALFYYCSICDFAVHMACAGNPTSPTIDNP 174


>At3g10390.1 68416.m01245 amine oxidase family protein / SWIRM
           domain-containing protein contains Pfam profile: PF01593
           Flavin containing amine oxidase
          Length = 789

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)
 Frame = -1

Query: 384 EQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ-MELHRGYGRSEGRCCY 217
           ++++   A QH   +L QQ   H  +QQ++Q    L  QQ ++L    G  E R  Y
Sbjct: 687 KRNEDPKADQHSNKILFQQLQSHFNQQQQIQVYTLLTRQQALDLREVRGGDEKRLYY 743


>At1g17440.2 68414.m02133 transcription initiation factor IID
           (TFIID) subunit A family protein similar to SP|Q16514
           Transcription initiation factor TFIID 20/15 kDa subunits
           (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam
           profile PF03847: Transcription initiation factor TFIID
           subunit A
          Length = 683

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 18/74 (24%), Positives = 36/74 (48%)
 Frame = -1

Query: 486 QIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLE 307
           Q+H  ++   L+     Q +QQ+Q + +   + + Q       Q     L QQ    + +
Sbjct: 411 QLHQSSMS--LNQQQISQIIQQQQQQSQLGQSQMNQSHSQQQLQQMQQQLQQQPQQQMQQ 468

Query: 306 QQKVQRRVQL*EQQ 265
           QQ+ Q+++Q+ +QQ
Sbjct: 469 QQQQQQQMQINQQQ 482


>At1g17440.1 68414.m02132 transcription initiation factor IID
           (TFIID) subunit A family protein similar to SP|Q16514
           Transcription initiation factor TFIID 20/15 kDa subunits
           (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam
           profile PF03847: Transcription initiation factor TFIID
           subunit A
          Length = 683

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 18/74 (24%), Positives = 36/74 (48%)
 Frame = -1

Query: 486 QIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLE 307
           Q+H  ++   L+     Q +QQ+Q + +   + + Q       Q     L QQ    + +
Sbjct: 411 QLHQSSMS--LNQQQISQIIQQQQQQSQLGQSQMNQSHSQQQLQQMQQQLQQQPQQQMQQ 468

Query: 306 QQKVQRRVQL*EQQ 265
           QQ+ Q+++Q+ +QQ
Sbjct: 469 QQQQQQQMQINQQQ 482


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,867,746
Number of Sequences: 28952
Number of extensions: 224486
Number of successful extensions: 944
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 816
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 913
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1295224128
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).