SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0027
         (611 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g03080.1 68414.m00282 kinase interacting family protein simil...    29   3.2  
At1g80210.1 68414.m09387 expressed protein                             27   7.4  
At1g75520.1 68414.m08776 lateral root primordium (LRP) protein-r...    27   7.4  
At1g27020.1 68414.m03294 expressed protein                             27   7.4  
At5g33210.1 68418.m03923 zinc finger protein-related similar to ...    27   9.8  
At3g51060.1 68416.m05591 zinc finger protein, putative / lateral...    27   9.8  

>At1g03080.1 68414.m00282 kinase interacting family protein similar to
            kinase interacting protein 1 (GI:13936326) [Petunia
            integrifolia]
          Length = 1744

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 10/28 (35%), Positives = 19/28 (67%)
 Frame = +3

Query: 516  TRDRVECCSSLEQESTIKERGLQRQRAK 599
            T + VE C +LE  ST+K+R +++ + +
Sbjct: 1344 TNELVEACKNLESRSTLKDREIEQLKGR 1371


>At1g80210.1 68414.m09387 expressed protein
          Length = 354

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = -1

Query: 335 QLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNTTHYRANWVPGPPSS 192
           + +K G +A  + W     S+S R K R  + N  +Y  +W+   PSS
Sbjct: 30  EYSKDGGSATAMIWGASPQSRSDRQKDRNDDINGQNYTGHWMVPLPSS 77


>At1g75520.1 68414.m08776 lateral root primordium (LRP)
           protein-related similar to lateral root primordium 1
           (LRP1) [Arabidopsis thaliana] GI:882341; contains Pfam
           profile PF05142: Domain of unknown function (DUF702)
          Length = 346

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = -1

Query: 263 CKTRPVNCNTTHYRANWVPGPPSSRRL 183
           CK+R  +C T H ++ WVP      RL
Sbjct: 145 CKSRGFHCQT-HVKSTWVPAAKRRERL 170


>At1g27020.1 68414.m03294 expressed protein
          Length = 308

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 10/21 (47%), Positives = 12/21 (57%)
 Frame = +1

Query: 274 WENPGVTQLNRLAAHPPFASW 336
           WE P  T  N+LA    FA+W
Sbjct: 163 WEKPTSTDFNQLAKESEFAAW 183


>At5g33210.1 68418.m03923 zinc finger protein-related similar to
           lateral root primordium 1 (LRP1) [Arabidopsis thaliana]
           GI:882341; contains Pfam profile PF05142: Domain of
           unknown function (DUF702),  TIGR01623: putative zinc
           finger domain, LRP1 type
          Length = 173

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = -1

Query: 263 CKTRPVNCNTTHYRANWVPGPPSSRR 186
           CK+R   C+T H R+ WVP      R
Sbjct: 72  CKSRGFECST-HVRSTWVPATKRRER 96


>At3g51060.1 68416.m05591 zinc finger protein, putative / lateral
           root primordium (LRP) protein-related similar to lateral
           root primordium 1 (LRP1) [Arabidopsis thaliana]
           GI:882341; contains Pfam profile PF05142: Domain of
           unknown function (DUF702)
          Length = 252

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = -1

Query: 263 CKTRPVNCNTTHYRANWVPGPPSSRR 186
           CK+R   C+T H R+ WVP      R
Sbjct: 164 CKSRGFECST-HVRSTWVPAAKRRER 188


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,523,567
Number of Sequences: 28952
Number of extensions: 276854
Number of successful extensions: 602
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 585
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 602
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1226538000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).