SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0026
         (630 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496...   192   1e-49
At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A...   192   2e-49
At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497...   192   2e-49
At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S...   190   5e-49
At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A...   190   9e-49
At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A...   190   9e-49
At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A...   187   5e-48
At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A...   187   5e-48
At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A...   187   5e-48
At2g42100.1 68415.m05205 actin, putative very strong similarity ...   173   8e-44
At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac...   164   5e-41
At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara...   163   9e-41
At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i...   116   2e-26
At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica...    97   1e-20
At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id...    87   9e-18
At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica...    70   1e-12
At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i...    64   1e-10
At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identica...    62   2e-10
At3g12380.1 68416.m01543 actin/actin-like family protein similar...    49   3e-06
At5g01040.1 68418.m00007 laccase family protein / diphenol oxida...    34   0.089
At3g51940.1 68416.m05697 expressed protein                             30   1.5  
At5g56180.2 68418.m07009 actin-related protein, putative (ARP8) ...    29   2.5  
At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) ...    29   2.5  
At5g50400.1 68418.m06242 calcineurin-like phosphoesterase family...    29   2.5  
At1g16690.2 68414.m01999 transcription factor-related similar to...    29   3.4  
At1g16690.1 68414.m01998 transcription factor-related similar to...    29   3.4  
At5g17420.1 68418.m02044 cellulose synthase, catalytic subunit (...    28   4.4  
At5g40350.1 68418.m04895 myb family transcription factor (MYB24)...    28   5.9  
At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c...    28   5.9  
At5g06610.1 68418.m00747 expressed protein contains Pfam profile...    27   7.8  
At4g30070.1 68417.m04277 plant defensin-fusion protein, putative...    27   7.8  

>At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496
           Actin 11 {Arabidopsis thaliana}
          Length = 377

 Score =  192 bits (469), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 6e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494
           Actin 4 {Arabidopsis thaliana}
          Length = 377

 Score =  192 bits (468), Expect = 2e-49
 Identities = 92/112 (82%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 6e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497
           Actin 12 {Arabidopsis thaliana}
          Length = 377

 Score =  192 bits (468), Expect = 2e-49
 Identities = 92/112 (82%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 6e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to
           SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana}
          Length = 377

 Score =  190 bits (464), Expect = 5e-49
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 6e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493
           Actin 3 {Arabidopsis thaliana}; supported by full-length
           cDNA: Ceres: 19581.
          Length = 377

 Score =  190 bits (462), Expect = 9e-49
 Identities = 90/112 (80%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 6e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671
           Actin 1 (Actin 3) {Arabidopsis thaliana}
          Length = 377

 Score =  190 bits (462), Expect = 9e-49
 Identities = 90/112 (80%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 6e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 377

 Score =  187 bits (456), Expect = 5e-48
 Identities = 87/112 (77%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +G++LP
Sbjct: 123 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLP 174



 Score =  106 bits (254), Expect = 1e-23
 Identities = 46/59 (77%), Positives = 53/59 (89%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSK
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSK 63


>At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 371

 Score =  187 bits (456), Expect = 5e-48
 Identities = 87/112 (77%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +G++LP
Sbjct: 123 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLP 174



 Score =  106 bits (254), Expect = 1e-23
 Identities = 46/59 (77%), Positives = 53/59 (89%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSK
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSK 63


>At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293
           Actin 8 {Arabidopsis thaliana}; nearly identical to
           SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and
           to At3g18780
          Length = 377

 Score =  187 bits (456), Expect = 5e-48
 Identities = 87/112 (77%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN+PAMYVAIQAVLSLYASG        S    S   P  +G++LP
Sbjct: 123 QIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLP 174



 Score =  106 bits (254), Expect = 1e-23
 Identities = 46/59 (77%), Positives = 53/59 (89%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSK
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSK 63


>At2g42100.1 68415.m05205 actin, putative very strong similarity to
           SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493
           Actin 3 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 378

 Score =  173 bits (421), Expect = 8e-44
 Identities = 79/112 (70%), Positives = 90/112 (80%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGIL+LKYPIEHG+V+NWDDMEKIWHHTFYNELR+ PEEHP+LLTEAPLNPK NREKMT
Sbjct: 64  RRGILSLKYPIEHGVVSNWDDMEKIWHHTFYNELRLEPEEHPILLTEAPLNPKVNREKMT 123

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFE+F  P+MY+ IQAVLSLY+SG        S    S   P  +GYALP
Sbjct: 124 QIMFESFAFPSMYIGIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALP 175



 Score =  102 bits (245), Expect = 2e-22
 Identities = 44/59 (74%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +E  A+V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH+GVMVGM +KD++VGDEAQ++
Sbjct: 6   DESVAIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHRGVMVGMDEKDTFVGDEAQAR 64


>At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin
           11 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 366

 Score =  164 bits (398), Expect = 5e-41
 Identities = 85/131 (64%), Positives = 95/131 (72%), Gaps = 1/131 (0%)
 Frame = +3

Query: 198 RDGRYGTEGLLCRR*GTEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 377
           RDG    E  +    G   R ILTLK P+EHGIV NWDDMEKIWH+TFYNELRV PEEHP
Sbjct: 35  RDGLNPNESYVGEE-GHANRDILTLKDPMEHGIVNNWDDMEKIWHYTFYNELRVDPEEHP 93

Query: 378 VLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG-VPPVSCWTSATVSST 554
           VLLTEAP NPKANREKMTQIMFE+F+ PAMYV++Q+VL LY+SG    V       VS T
Sbjct: 94  VLLTEAPYNPKANREKMTQIMFESFDVPAMYVSMQSVLYLYSSGRTTGVVLDLGERVSHT 153

Query: 555 PCPFTKGYALP 587
             P  +GYALP
Sbjct: 154 -VPVYEGYALP 163



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 27/53 (50%), Positives = 36/53 (67%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 252
           +V D G GM +AGFAGD+AP+ VFP +VGRPR      G+   +SYVG+E  +
Sbjct: 4   IVCDKGHGMVQAGFAGDEAPKVVFPCVVGRPRD-----GLNPNESYVGEEGHA 51


>At2g42170.1 68415.m05219 actin, putative similar to actin 2
           [Arabidopsis thaliana] gi|9293903|dbj|BAB01806
          Length = 329

 Score =  163 bits (396), Expect = 9e-41
 Identities = 76/110 (69%), Positives = 88/110 (80%)
 Frame = +3

Query: 258 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 437
           GILTL YP+EHG+V+NWDDMEKIW+HTFY+ELRVAPEEHPVLLTEAPLNPKA+REKMTQI
Sbjct: 20  GILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPVLLTEAPLNPKADREKMTQI 79

Query: 438 MFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           MFETF  P+MY+ +QA LSL+ASG    +   S    S   P  +G ALP
Sbjct: 80  MFETFAVPSMYIGMQAALSLHASGRTTGTVLDSGDGVSYIVPIYEGSALP 129


>At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly
           identical to actin-related protein 2 (ARP2) [Arabidopsis
           thaliana] GI:3818624; contains Pfam profile PF00022:
           Actin
          Length = 389

 Score =  116 bits (278), Expect = 2e-26
 Identities = 52/114 (45%), Positives = 71/114 (62%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 425
           +E R  L + YP+ +GIV NWDDME +W H FYNEL++ P +  +LLT+ PLNP  NREK
Sbjct: 60  SELRHQLDINYPVHNGIVQNWDDMEHVWDHAFYNELKINPSDCKILLTDPPLNPSKNREK 119

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           M + MFE +N   +++ IQAVL+LYA G+       S    +   P   GY+ P
Sbjct: 120 MIETMFEKYNFAGVFIQIQAVLTLYAQGLLTGLVIDSGDGVTHVVPVVDGYSFP 173



 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGD 240
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  ++    KD  VG+
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLMEQQVKDIVVGE 57


>At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical
           to actin-related protein 3 (ARP3) [Arabidopsis thaliana]
           GI:21427461; contains Pfam profile PF00022: Actin
          Length = 427

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 44/92 (47%), Positives = 59/92 (64%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 449
           L YPIEHG V +WD ME+ W    +N LR  PE+H  LLTE+PL P  +RE   +I+FET
Sbjct: 86  LHYPIEHGQVEDWDAMERYWQQCIFNYLRCDPEDHYFLLTESPLTPPESREYTGEILFET 145

Query: 450 FNTPAMYVAIQAVLSLYASGVPPVSCWTSATV 545
           FN P +Y+A+ +VL+L A+G     C  +  V
Sbjct: 146 FNVPGLYIAVNSVLAL-AAGYTTSKCEMTGVV 176



 Score = 35.9 bits (79), Expect = 0.022
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 177
           A+V+DNG+G  K GFAG+  P  + P++V
Sbjct: 8   AIVIDNGTGYTKMGFAGNVEPCFILPTVV 36



 Score = 30.3 bits (65), Expect = 1.1
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = +2

Query: 515 TGIVLDFGDGVFHTVPIYE 571
           TG+V+D GDG  H VP+ E
Sbjct: 173 TGVVVDVGDGATHVVPVAE 191


>At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary
           identical to actin-related protein 4 (ARP4) [Arabidopsis
           thaliana] GI:21427463; contains Pfam profile PF00022:
           Actin; supporting cDNA gi|21427462|gb|AF507912.1|
          Length = 441

 Score = 87.0 bits (206), Expect = 9e-18
 Identities = 41/102 (40%), Positives = 60/102 (58%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           PI+ GIV++WD ++ IW H F + L + P EHP+LL E PLN +  REK  ++MFE +  
Sbjct: 94  PIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPLNTQQQREKAAELMFEKYKV 153

Query: 459 PAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           PA+++A   VL+ +A+G            S+T  P   GY L
Sbjct: 154 PALFMAKNPVLTSFATGRATSLVVDCGGGSTTISPVHDGYVL 195



 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 38


>At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical
           to actin-related protein 7 (ARP7) [Arabidopsis thaliana]
           GI:21427469; contains Pfam profile PF00022: Actin
          Length = 363

 Score = 69.7 bits (163), Expect = 1e-12
 Identities = 35/78 (44%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA RE++ Q+MFETFN
Sbjct: 57  PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQLVQLMFETFN 116

Query: 456 TPAMYVAIQAVLSLYASG 509
               Y + QAVLSLYA G
Sbjct: 117 VSGFYASEQAVLSLYAVG 134



 Score = 27.5 bits (58), Expect = 7.8
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGR 183
           ALVVD GS   KAG A  D +P  + PS + R
Sbjct: 3   ALVVDAGSKFLKAGAAIPDQSPAMIIPSQMKR 34


>At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly
           identical to actin-related protein 6 (ARP6) [Arabidopsis
           thaliana] GI:21427467; contains Pfam profile PF00022:
           Actin
          Length = 421

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 35/112 (31%), Positives = 61/112 (54%), Gaps = 2/112 (1%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 449
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 61  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 120

Query: 450 FNTPAMYVA-IQAVLSLYASGVPPVSCWTSATVS-STPCPFTKGYALPPRHS 599
           F   ++Y+A  Q+++ LY +   P S  +    S    C F+  +A+P  H+
Sbjct: 121 FGFSSLYIAHPQSLVHLYEASRQPDSILSKTQCSLVVDCGFSFTHAVPVLHN 172



 Score = 32.7 bits (71), Expect = 0.21
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           +V+DNG G+ KAG  G+  P  V P+ + +P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35


>At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identical
           to actin-related protein 5 (ARP5) GI:21489922 from
           [Arabidopsis thaliana]
          Length = 145

 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 26/58 (44%), Positives = 37/58 (63%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 425
           +R  + +  P + GIVT+WD ++ +W H F N L + P EHP+LL E PLN +  REK
Sbjct: 79  RRDQMEILSPTKDGIVTDWDMVDNVWDHAFRNCLMIDPTEHPMLLAEPPLNSQQQREK 136



 Score = 57.2 bits (132), Expect = 8e-09
 Identities = 24/34 (70%), Positives = 31/34 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS+VG
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVG 38


>At3g12380.1 68416.m01543 actin/actin-like family protein similar to
           SP|P53946 Actin-like protein ARP5 {Saccharomyces
           cerevisiae}; contains Pfam profile PF00022: Actin
          Length = 724

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           P +  +V  ++ ME I  + F       +  +HP+L+TE   NP  +R KM +++FET+ 
Sbjct: 85  PFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMAELLFETYG 144

Query: 456 TPAMYVAIQAVLS 494
            PA+   + A  S
Sbjct: 145 VPAVAFGVDAAFS 157



 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 240
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGD 66


>At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase
           family protein similar to laccase [Pinus
           taeda][GI:13661201], lac110 laccase, Populus
           trichocarpa, EMBL:PTY13773
          Length = 584

 Score = 33.9 bits (74), Expect = 0.089
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = -2

Query: 215 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 78
           P P I P  RGL   +G T+  +SSPA+P + +P  +ST +  TS+
Sbjct: 290 PTPDIKP-TRGLIVYQGATS--SSSPAEPLMPVPNDMSTAHRFTSN 332


>At3g51940.1 68416.m05697 expressed protein 
          Length = 453

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 1/32 (3%)
 Frame = -2

Query: 566 KWARCGRH-RRRSPARYRWYAGRVQREHGLDG 474
           KW    RH RRRSP   RWY+GR       DG
Sbjct: 3   KWNHRSRHHRRRSPE--RWYSGRQSSSSSDDG 32


>At5g56180.2 68418.m07009 actin-related protein, putative (ARP8)
           strong similarity to actin-related protein 8A (ARP8)
           [Arabidopsis thaliana] GI:21427473; contains Pfam
           profile PF00022: Actin; supporting cDNA
           gi|21427470|gb|AF507916.1|
          Length = 387

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 10/67 (14%)
 Frame = +3

Query: 336 TFYNELRVAPEEHPVLLTEAPL-------NPKANREKMTQIMFETF---NTPAMYVAIQA 485
           T +  ++V P   P++++  PL       + KA+R ++   +F      N PA+    QA
Sbjct: 182 TIFTRMQVKPSMQPIVVS-LPLCHFDDTESAKASRRQLKTAIFNVLFDMNVPAVCAVNQA 240

Query: 486 VLSLYAS 506
           VL+LYA+
Sbjct: 241 VLALYAA 247


>At5g56180.1 68418.m07008 actin-related protein, putative (ARP8)
           strong similarity to actin-related protein 8A (ARP8)
           [Arabidopsis thaliana] GI:21427473; contains Pfam
           profile PF00022: Actin; supporting cDNA
           gi|21427470|gb|AF507916.1|
          Length = 471

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 10/67 (14%)
 Frame = +3

Query: 336 TFYNELRVAPEEHPVLLTEAPL-------NPKANREKMTQIMFETF---NTPAMYVAIQA 485
           T +  ++V P   P++++  PL       + KA+R ++   +F      N PA+    QA
Sbjct: 182 TIFTRMQVKPSMQPIVVS-LPLCHFDDTESAKASRRQLKTAIFNVLFDMNVPAVCAVNQA 240

Query: 486 VLSLYAS 506
           VL+LYA+
Sbjct: 241 VLALYAA 247


>At5g50400.1 68418.m06242 calcineurin-like phosphoesterase family
           protein contains Pfam profile: PF00149 calcineurin-like
           phosphoesterase
          Length = 611

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = -2

Query: 605 TQGMAWGKCVSFRKWARCGRHRRRSPA 525
           T G   G+ V F +W+R G   RRSPA
Sbjct: 187 TSGYNIGEAVPFVEWSRKGTRSRRSPA 213


>At1g16690.2 68414.m01999 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 425
           L++KY + H I + W +  +IW       L+  P   PV  T  P N    REK
Sbjct: 178 LSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP---PVNDTN-PYNVFRPREK 227


>At1g16690.1 68414.m01998 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 425
           L++KY + H I + W +  +IW       L+  P   PV  T  P N    REK
Sbjct: 178 LSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP---PVNDTN-PYNVFRPREK 227


>At5g17420.1 68418.m02044 cellulose synthase, catalytic subunit
           (IRX3) identical to gi:5230423
          Length = 1026

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 3/37 (8%)
 Frame = +2

Query: 392 GSPQPQGQQREDDPDHVR---NIQHARHVRRHPSRAL 493
           GSP+ +G + E+D D +    NI+H +   +H + A+
Sbjct: 91  GSPRVEGDEDEEDIDDIEYEFNIEHEQDKHKHSAEAM 127


>At5g40350.1 68418.m04895 myb family transcription factor (MYB24)
           similar to Myb26 GI:1841475 from [Pisum sativum]
          Length = 214

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = -3

Query: 589 GGSAYPFVNGHGVEDTVAEVQHDTGGTPDAYSESTAWM-ATYMAGVLNVSNMI 434
           G  +  F+N H    T + V +DT  T D YS +T++  A+ +   LN  N +
Sbjct: 131 GSQSSEFINHHA---TTSHVMNDTQETMDMYSPTTSYQHASNINQQLNYGNYV 180


>At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein
           contains Pfam PF01422: NF-X1 type zinc finger; similar
           to transcriptional repressor NF-X1 (SP:Q12986) [Homo
           sapiens]; similar to EST gb|T21002
          Length = 1188

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 12/36 (33%), Positives = 14/36 (38%)
 Frame = +3

Query: 513 PPVSCWTSATVSSTPCPFTKGYALPPRHSLRFGT*P 620
           PP+SC T       PCP  +       H   FG  P
Sbjct: 647 PPLSCGTPVPSCQLPCPIPQPCGHSDTHGCHFGDCP 682


>At5g06610.1 68418.m00747 expressed protein contains Pfam profile
           PF04788: Protein of unknown function (DUF620)
          Length = 368

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -2

Query: 191 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSHI 69
           WR  P +  + A+GA  P + AL   +PL+ ++  +S+  +
Sbjct: 167 WRYTPWLGDHAAKGAIRPLRRALQGLDPLTISSVFSSAQFV 207


>At4g30070.1 68417.m04277 plant defensin-fusion protein, putative
           contains a C-terminal plant defensin domain, personal
           communication, Bart Thomma
           (Bart.Thomma@agr.kuleuven.ac.be)
          Length = 129

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -3

Query: 268 VRIPLCSVPHLLHKSPSVPYRPSRPDGGA 182
           V +PLC   +     PS P  P + DGGA
Sbjct: 59  VGVPLCKCYYECESPPSPPAPPKKCDGGA 87


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,293,319
Number of Sequences: 28952
Number of extensions: 394528
Number of successful extensions: 1238
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 1130
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1222
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1285411824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).