SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0025
         (588 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g27080.2 68415.m03254 harpin-induced protein-related / HIN1-r...    30   1.3  
At2g27080.1 68415.m03253 harpin-induced protein-related / HIN1-r...    30   1.3  
At3g06150.1 68416.m00707 expressed protein                             29   2.3  
At3g47330.1 68416.m05144 hypothetical protein contains Pfam prof...    29   3.0  
At1g05590.1 68414.m00579 glycosyl hydrolase family 20 protein si...    29   3.0  
At4g08480.1 68417.m01399 mitogen-activated protein kinase, putat...    28   4.0  
At5g44415.1 68418.m05439 hypothetical protein contains Pfam prof...    28   5.3  
At1g10050.1 68414.m01133 glycosyl hydrolase family 10 protein / ...    28   5.3  
At5g40670.1 68418.m04937 PQ-loop repeat family protein / transme...    27   7.0  
At1g03370.1 68414.m00316 C2 domain-containing protein / GRAM dom...    27   7.0  
At3g25180.1 68416.m03144 cytochrome P450 family protein similar ...    27   9.3  
At3g24870.1 68416.m03119 expressed protein                             27   9.3  
At2g29310.1 68415.m03560 tropinone reductase, putative / tropine...    27   9.3  
At1g66500.1 68414.m07554 zinc finger (C2H2-type) family protein ...    27   9.3  

>At2g27080.2 68415.m03254 harpin-induced protein-related /
           HIN1-related / harpin-responsive protein-related
           contains 1 transmembrane domain; similar to hin1 homolog
           (GI:13122296) [Arabidopsis thaliana]; similar to hin1
           (GI:22830759) [Nicotiana tabacum]
          Length = 260

 Score = 29.9 bits (64), Expect = 1.3
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 2/75 (2%)
 Frame = -2

Query: 335 HRGRAWSR--TNRKYSLCCICTF*IRHYSSAVGLLVVLQIQSSSAIFLLVRFFKVKRFPD 162
           HR    SR  TNR    CC C+F      +AV +L+VL   S + ++L+ R       P 
Sbjct: 56  HRFEQLSRKKTNRSNCRCCFCSF-----LAAVFILIVLAGISFAVLYLIYR----PEAPK 106

Query: 161 CSIVVHTVNDIKINA 117
            SI   +V+ I +N+
Sbjct: 107 YSIEGFSVSGINLNS 121


>At2g27080.1 68415.m03253 harpin-induced protein-related /
           HIN1-related / harpin-responsive protein-related
           contains 1 transmembrane domain; similar to hin1 homolog
           (GI:13122296) [Arabidopsis thaliana]; similar to hin1
           (GI:22830759) [Nicotiana tabacum]
          Length = 260

 Score = 29.9 bits (64), Expect = 1.3
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 2/75 (2%)
 Frame = -2

Query: 335 HRGRAWSR--TNRKYSLCCICTF*IRHYSSAVGLLVVLQIQSSSAIFLLVRFFKVKRFPD 162
           HR    SR  TNR    CC C+F      +AV +L+VL   S + ++L+ R       P 
Sbjct: 56  HRFEQLSRKKTNRSNCRCCFCSF-----LAAVFILIVLAGISFAVLYLIYR----PEAPK 106

Query: 161 CSIVVHTVNDIKINA 117
            SI   +V+ I +N+
Sbjct: 107 YSIEGFSVSGINLNS 121


>At3g06150.1 68416.m00707 expressed protein 
          Length = 594

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 2/42 (4%)
 Frame = +3

Query: 300 FPVRSTPSASTMVSSQPLIMAEGTASPNVTL--TPQDLIYKK 419
           + VR +PS S  +S++P +++E     N+TL   P++L+ KK
Sbjct: 62  YSVRISPSPSPFMSTKPNLVSEKPHRQNLTLMMAPRNLVPKK 103


>At3g47330.1 68416.m05144 hypothetical protein contains Pfam profile
           PF03384: Drosophila protein of unknown function, DUF287
          Length = 664

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 12/41 (29%), Positives = 24/41 (58%)
 Frame = +1

Query: 460 DRITDRTVTSDAEKIIVLLRQQTLQQYLVRECEFKAFNIRY 582
           D++TD+    D+E   + +R Q +++Y+  + E +A   RY
Sbjct: 522 DKLTDKLAVMDSEIKRICVRVQGIEEYVADQLEKEAEKARY 562


>At1g05590.1 68414.m00579 glycosyl hydrolase family 20 protein
           similar to beta-hexosaminidase precursor SP:P43077 from
           [Candida albicans]
          Length = 580

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 13/59 (22%), Positives = 27/59 (45%)
 Frame = +3

Query: 231 YYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDL 407
           YY   D  R +            + +  + S   ++ S+P + A+G+  P++  TP+D+
Sbjct: 184 YYGVDDIMRTIKAMSANKLNVFHWHITDSQSFPLVLPSEPSLAAKGSLGPDMVYTPEDV 242


>At4g08480.1 68417.m01399 mitogen-activated protein kinase, putative
           similar to mitogen-activated protein kinase [Arabidopsis
           thaliana] gi|1255448|dbj|BAA09057; contains Pfam
           PF00069: Protein kinase domain
          Length = 773

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = +2

Query: 269 FRRYKCNTSCISGSFYSKRVHDGLQPAFNNGRGHSVTKC 385
           +RRY+   S IS   Y+K++ DGL+   + G  H   KC
Sbjct: 591 YRRYQIRDSLIS--LYTKQILDGLKYLHHKGFIHRDIKC 627


>At5g44415.1 68418.m05439 hypothetical protein contains Pfam profile
           PF03384: Drosophila protein of unknown function, DUF287
          Length = 611

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 12/41 (29%), Positives = 24/41 (58%)
 Frame = +1

Query: 460 DRITDRTVTSDAEKIIVLLRQQTLQQYLVRECEFKAFNIRY 582
           D++TD+    D+E   + LR Q +++Y+  + E +A   +Y
Sbjct: 467 DKLTDKLAVMDSEIKRICLRVQGIEEYVADQLEKEAEKDKY 507


>At1g10050.1 68414.m01133 glycosyl hydrolase family 10 protein /
           carbohydrate-binding domain-containing protein similar
           to GB:AAD27896 to endoxylanases gi|1255238
           (Thermoanaerobacterium thermosulfurigenes), gi|1813595
           (Hordeum vulgare) and others ; contains Pfam profiles
           PF00331: Glycosyl hydrolase family 10, PF02018:
           Carbohydrate binding domain
          Length = 1063

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +2

Query: 248 LQKNNAEFRRYKCNTSCISGSFYSKRV 328
           L + N +FR Y  N   + GSFY  R+
Sbjct: 825 LTRYNGKFRHYDVNNEMLHGSFYRDRL 851


>At5g40670.1 68418.m04937 PQ-loop repeat family protein /
           transmembrane family protein similar to SP|O60931
           Cystinosin {Homo sapiens}; contains Pfam profile
           PF04193: PQ loop repeat
          Length = 270

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = -1

Query: 549 SHQILLKCL--LPQQNNNFLCIGRHCTVGYSVGNLAL 445
           S Q+ + C+  +PQ   NF    R  TVG+S+GN+ L
Sbjct: 157 SIQVFMTCVKYIPQAKMNFT---RKSTVGWSIGNILL 190


>At1g03370.1 68414.m00316 C2 domain-containing protein / GRAM
            domain-containing protein contains Pfam profiles PF00168:
            C2 domain; contains PF02893: GRAM domain; similar to
            Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B
            Length(GI:6980525); similar to Synaptotagmin III (SytIII)
            (Swiss-Prot:P40748) [Rattus norvegicus]
          Length = 1859

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 3/64 (4%)
 Frame = +3

Query: 114  VRVYFDVVYRVHNN*--TIWKPFNFEEADEKKNCRR-RLDLEYYQKSDCRRIMPNSEGTN 284
            VRV   +V+   N    T+W P N ++   KK+C    L + + QK+    +  + + T+
Sbjct: 908  VRVSVSLVFDAENQSLGTVWYPLNPKKKGSKKDCGEILLKICFSQKNSVLDLTSSGDQTS 967

Query: 285  ATQA 296
            A+++
Sbjct: 968  ASRS 971


>At3g25180.1 68416.m03144 cytochrome P450 family protein similar to
           cytochrome P450 monooxygenase GB:AAC49188 [Pisum
           sativum]; contains Pfam profile: PF00067 cytochrome P450
          Length = 515

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 24/96 (25%), Positives = 37/96 (38%), Gaps = 4/96 (4%)
 Frame = +3

Query: 135 VYRVHNN*TIW---KPFNFEEADEKKNCRRRLDLEYYQKSDCRRIMPNSE-GTNATQAVF 302
           ++++H +  IW   K F  E   E K+   + + EY      RR  P    G      V 
Sbjct: 407 IWKLHRDPKIWPDPKTFKPERFMEDKSQCEKSNFEYIPFGSGRRSCPGVNLGLRVVHFVL 466

Query: 303 PVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLI 410
                      VS +PL MAEG       + P +++
Sbjct: 467 ARLLQGFELHKVSDEPLDMAEGPGLALPKINPVEVV 502


>At3g24870.1 68416.m03119 expressed protein
          Length = 1841

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 18/73 (24%), Positives = 30/73 (41%)
 Frame = +3

Query: 210  RRRLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVT 389
            +R L  +  Q      +MP+ +    +      +++P     VS QPL M   + SPN+ 
Sbjct: 1409 QRYLQQQQQQFPASGSMMPHVQQPQGSSVSSSSQNSPQTQPPVSPQPLSMPPVSPSPNIN 1468

Query: 390  LTPQDLIYKKCLS 428
               Q    K  L+
Sbjct: 1469 AMAQQKPQKSQLA 1481


>At2g29310.1 68415.m03560 tropinone reductase, putative / tropine
           dehydrogenase, putative similar to tropinone reductase
           SP:P50165 from [Datura stramonium]
          Length = 262

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 17/52 (32%), Positives = 26/52 (50%)
 Frame = +2

Query: 200 EKLQKTIGSGVLPKVRLQKNNAEFRRYKCNTSCISGSFYSKRVHDGLQPAFN 355
           EKL +T+ S    K+ +  NN    R K  T  ++  F S  +   L+PAF+
Sbjct: 74  EKLMQTVSSLFDGKLNILVNNVGVIRGKPTTEYVAEDF-SYHISTNLEPAFH 124


>At1g66500.1 68414.m07554 zinc finger (C2H2-type) family protein
           contains Prosite PS00028: Zinc finger, C2H2 type,
           domain; similar to S-locus protein 4 (GI:6069478)
           [Brassica rapa]; similar to Pre-mRNA cleavage complex II
           protein Pcf11 (Fragment) (Swiss-Prot:O94913) [Homo
           sapiens]
          Length = 416

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 18/63 (28%), Positives = 31/63 (49%)
 Frame = +3

Query: 285 ATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMPDYRQ 464
           A+ + F +R+  S +T    +P +   G  +PN  + P  L Y+K    L    +PD+  
Sbjct: 92  ASNSSFALRNNDS-NTNNYQKPFVAGYG--NPNPQIVPLPLPYRKLDDNLSLDSLPDWVP 148

Query: 465 NNR 473
           N+R
Sbjct: 149 NSR 151


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,205,916
Number of Sequences: 28952
Number of extensions: 257047
Number of successful extensions: 717
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 710
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 717
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1161268208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).